(data stored in ACNUC7421 zone)

EMBL: CR954246.PE121

CR954246.PE121       Location/Qualifiers
FT   CDS_pept        complement(140704..141423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0131"
FT                   /product="putative response regulator in two-component
FT                   regulatory system"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85235"
FT                   /db_xref="GOA:Q3IDF5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDF5"
FT                   /protein_id="CAI85235.1"
FT                   /translation="MTIHVLLVEDDELLVKRIQNHFTNTEFTIEVDPTGADALSTIRSR
FT                   VNLRGAFSLAIIDIVLPKRDGLQLAKELNTLTDIGVILLSSRDSQADRIAGLAQGADDY
FT                   ICKPVDLLELELRMRALYKRIAHLNSDNDKNDDNGEEFIEYADFKLHPDNRTLITATGA
FT                   ESRLTEAEHKVLICLIGNAGKATSREKISEEIGQPDWSPNDRTVDVLIGRLRKKLNDEK
FT                   DQKRIVTVRGKGYMLSI"
     atgactattc atgttttatt ggttgaggac gacgaattac tcgttaaacg catccaaaat        60
     cattttacaa ataccgagtt tacaatagaa gttgacccta ctggcgccga tgcactgagc       120
     actataaggt cgcgagttaa tttgcgcggt gctttttcat tagccattat tgatattgtt       180
     ttaccaaagc gcgacggctt acaacttgca aaagagctaa atacccttac cgatattggc       240
     gtaattttat tatcgagccg tgattcacag gccgatcgca ttgctggcct tgcccaaggc       300
     gcagacgact acatatgcaa acccgtagac ttacttgaac tagagctgcg catgcgtgct       360
     ttatataaac gcattgcaca cttaaattca gacaatgata aaaacgatga taacggcgaa       420
     gagtttatag aatatgccga ctttaaatta caccccgaca accgcacact aattacagct       480
     acaggagctg aatcgcgctt aaccgaagcg gaacataaag tacttatttg tttaattggt       540
     aacgcaggta aagcaacttc tcgcgaaaaa atatctgaag aaataggcca gcctgattgg       600
     agcccaaacg atcgtactgt tgatgtgtta attggccgtt tgcgtaaaaa attaaatgat       660
     gaaaaagatc aaaagcgcat tgttactgta cgcggtaaag gttatatgct ctctatttag       720
//

If you have problems or comments...

PBIL Back to PBIL home page