(data stored in ACNUC7421 zone)

EMBL: CR954246.PE122

CR954246.PE122       Location/Qualifiers
FT   CDS_pept        complement(141653..144154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0132"
FT                   /product="putative secreted hydrolase"
FT                   /function="5.2 : From other organisms"
FT                   /EC_number="3.4.19.1"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85236"
FT                   /db_xref="GOA:Q3IDF4"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDF4"
FT                   /protein_id="CAI85236.1"
FT                   /translation="MKLNALWRHSNKLFKHSFALFTLSSLSFAAFAAPLDKSKIQFIGP
FT                   LAENMQLKPFQTAQSDSIISNLLPQLQLPVANFSVFDKKHSWQPFNKINALTLGGLQAL
FT                   KFNIETTRFSQGTLTLKGIEQGQLFINGELQKADNSSYKLALNNGSHTAIIVAQQVANW
FT                   HDVILDFAPKTPSDNITLSTSQTKRLSAKQLFDAPTISGLSLAPNSEHYITTTRRFNDK
FT                   TLNQANNVTELKNTDNQTLYRFEAEQPSNLIWSPDNRFLVYLLNGELKQLNRKNLSIKT
FT                   LSTRLEGASGFTFYNEHSVIFSWSNPASDKGNDKLTKHYKGLQDRWSYARSVSQVYMLD
FT                   TQSGLIKTLSQGPLSHSFEDFNNKRGKLLMSRPVVAMQASTHPETELVELDLKSNKLTS
FT                   LGKFKTFNQAKYANKDVYVVAGPDFKNGAGRALPKEMLANNYDGQLYLLTDGGKNVKAL
FT                   SKQFDPAIGRLSVLNNGDALLKVTEHDTQPLYLFDLSKQRFKKLNTGLDIVEQFSYSNE
FT                   RNIEILLSGTTASSPQQLKRFNISKNTAKIVWDSKPLSYANTYIPTLEEFNFTNKNGVE
FT                   ISGRVYIPNNLDKTKKHPALVYYYGGTSPVTRGFTGRYPFNLWAANGYVVYVIQPTGAT
FT                   GFGQKFSAQHVNAWGNYTSDDIIAGTQAFLNKYNYVDSKKVGNLGASYGGFMTMHLATK
FT                   TDLFSASISHAGISNLTSYWGEGWWGYLYSGEASKNSFPWNNPELYSKHSPVFYADKVT
FT                   TPMLLIHGDSDTNVPVGESLTMYTALKLLNKDVELIEYKGANHQIIARDQRFDWWNTML
FT                   AYFDKKLKNEPQWWDYLYPND"
     atgaaactta acgcactttg gcgtcatagc aataaactat tcaaacactc ctttgccctt        60
     tttactctta gcagcttaag ttttgccgcg tttgcagcgc cgcttgataa atctaaaatt       120
     caatttattg gtccactggc tgaaaacatg caattaaagc cttttcaaac ggcccaaagc       180
     gatagcataa ttagtaactt attaccccag ctacaactcc ccgtagctaa cttttcggtg       240
     tttgacaaaa aacacagctg gcagccattt aataaaataa atgcactcac tttaggcggc       300
     ttacaggcac ttaagtttaa tatagaaacc acgcgtttta gccaaggtac gttaacctta       360
     aaaggcattg aacaagggca attgtttata aatggcgaat tgcaaaaggc agataacagc       420
     agctacaaac tcgccttaaa taatggtagt catactgcta ttattgttgc gcaacaagtt       480
     gcaaattggc acgatgtaat actcgacttt gcaccaaaaa caccgagcga taacattacc       540
     cttagtactt cacaaactaa gcgtttatcg gcaaaacaat tatttgatgc tcccactatt       600
     agcggcttat cattagcgcc aaactcagag cactatatta cgacaacgcg ccgctttaat       660
     gataaaacac taaatcaagc aaacaatgta actgaactta aaaacaccga caatcaaaca       720
     ctgtatcgct ttgaggcaga acaaccaagc aaccttattt ggagcccaga caaccgcttt       780
     ttagtgtatt tactaaatgg tgaattaaaa caacttaacc gtaaaaattt atcaataaaa       840
     accctctcta ctcgcttaga aggcgctagc ggttttacct tttataacga gcacagtgta       900
     atatttagtt ggtctaaccc tgcatctgac aagggtaatg acaaactcac gaagcattat       960
     aaagggttac aagatcgctg gtcatacgca cgttcagtaa gccaagttta tatgcttgat      1020
     acgcaaagtg gtttaataaa aacacttagc caagggccac tttcgcatag ctttgaagac      1080
     tttaacaata agcgcggtaa actattaatg agccgccctg tagtcgctat gcaagcgtca      1140
     actcacccag aaacagaact agtagagctt gatttaaaat caaataagct tacttctttg      1200
     ggtaaattta aaacttttaa tcaggccaag tacgccaata aagatgtgta tgttgttgca      1260
     ggtcccgact ttaaaaatgg ggccggtaga gcattgccaa aagaaatgct agcgaataac      1320
     tacgacggtc aactttacct gcttacagac ggcggaaaaa acgttaaagc actcagtaaa      1380
     cagtttgatc cagcaattgg aagactgagt gttttaaaca atggcgacgc attgctaaag      1440
     gttactgagc acgacaccca accgctctac ctatttgatt taagtaagca gcgctttaaa      1500
     aaattaaata ctggtttaga tattgttgag cagtttagct actcaaacga gcgcaacatt      1560
     gaaatattac tcagtggcac cacggcttct agtccacaac aattaaagcg gtttaatata      1620
     agtaaaaaca ccgctaaaat agtctgggat tcaaagccac ttagctatgc aaatacatac      1680
     attccaactc tcgaagaatt taatttcact aataaaaatg gcgttgaaat ttcagggcgt      1740
     gtttacatcc caaataatct tgataaaact aaaaaacacc cagcgctagt ttattactat      1800
     ggcggcacat cgccagtgac acgaggcttt actggacgtt atccgtttaa tttatgggca      1860
     gcaaacgggt atgtggttta tgtaatccag ccaacaggcg ctaccggctt tgggcaaaag      1920
     ttttcggcgc agcacgttaa tgcgtggggc aactacacca gcgacgatat aattgcaggc      1980
     acgcaggcat ttttaaataa atacaactat gtagatagca aaaaggtagg caacttaggt      2040
     gcctcttacg gtggctttat gactatgcat ttagcgacta aaaccgactt atttagcgca      2100
     tcgatttctc atgctggtat ttctaacctc acatcttact ggggtgaagg atggtggggc      2160
     tacttatatt ctggcgaagc gtctaaaaac agctttccgt ggaataaccc cgagctttat      2220
     agtaaacata gcccagtatt ttatgccgat aaagtaacca cgcctatgct actcattcat      2280
     ggtgacagtg atactaacgt acccgttggc gaaagcttaa ctatgtacac cgcacttaaa      2340
     ttacttaata aagatgtaga gttaatagaa tataaaggtg cgaaccatca aattattgcc      2400
     cgcgatcaac gttttgattg gtggaatacc atgttagctt attttgataa aaaacttaaa      2460
     aatgagccac aatggtggga ttatctttac cctaacgact ag                         2502
//

If you have problems or comments...

PBIL Back to PBIL home page