(data stored in ACNUC7421 zone)

EMBL: CR954246.PE123

CR954246.PE123       Location/Qualifiers
FT   CDS_pept        144239..145315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0133"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.1 : From P. haloplanktis"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85237"
FT                   /db_xref="GOA:Q3IDF3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDF3"
FT                   /protein_id="CAI85237.1"
FT                   /translation="MTLLIVYMVVAIVISFLCSVMEAVLLSISPSYVALLRKKQPVLAK
FT                   QLEKLKNNIDQPLAAILTLNTVAHTAGAAGVGAQAAIVFSDAAVGVASAVMTLFVLVFS
FT                   EIIPKTLGANYWRVLTPSVTYGLRFLVILLKPFVWLAQKLTNLMGPKHDQAYYIRQEIE
FT                   AMADIGTESGALHQDESEIIRNLLHFRHAKLCDLMTPRTVIFKVHKDLTVNEYLNLHGS
FT                   SSFSRILVFDKDTDDIIGFVHKNDIMLACHRLGSDYKISKLVKPIYTVPSSQNASSLLQ
FT                   TLLTDRTHICLVVDEYGDVQGIVTLEDMIEALMGLEIVDERDQSTNMRAVAKQRWHKRL
FT                   ANSKNLVTEEDKHPRGDN"
     atgacattac tgatagttta tatggtcgtt gccattgtta tttcattttt atgctcagta        60
     atggaagccg tgctgttaag catttcacct agttatgttg cattactgcg taaaaagcag       120
     cctgtattag ctaagcagct cgaaaagcta aaaaataata ttgatcagcc attagcggct       180
     attttaacgc ttaatacggt ggcgcatacc gccggagccg ctggagttgg cgcgcaagca       240
     gctattgtat tttcggatgc agcagtaggg gttgcctctg cagtgatgac tttatttgtg       300
     ctggtgtttt ctgaaatcat acctaaaacg ttaggagcaa actattggcg agtacttacc       360
     ccaagtgtga cttacggttt acgtttttta gttatattgc ttaaaccttt tgtatggctt       420
     gcacaaaagc tgacaaattt aatgggacca aagcatgacc aagcctatta tattcgccaa       480
     gaaatagaag ccatggccga tataggcact gagtcggggg cgctgcacca agatgagtct       540
     gaaataattc gtaacttatt acattttaga catgccaaat tatgcgattt gatgacccca       600
     cgtacagtta tttttaaagt tcataaagac ttaaccgtaa acgaatactt gaacctgcat       660
     ggttcgtcgt cgttttctcg aatattagtg tttgataaag acactgacga tattatcggc       720
     tttgtgcata aaaacgatat tatgttggca tgtcatcgct taggtagcga ttacaaaatt       780
     agtaaactag taaagccaat ctatacggtt cctagttcgc aaaatgcgtc gtcgttgtta       840
     caaactctat taacagaccg cacgcatatt tgtttagtgg ttgatgagta tggcgacgta       900
     cagggtattg ttacgcttga ggacatgatt gaagcactaa tgggtttaga aattgtagat       960
     gagcgtgatc agtccactaa tatgcgtgcg gttgcgaagc agcgttggca taaacgtttg      1020
     gcaaatagta aaaacttagt cactgaagag gataaacacc ctagaggaga caactaa         1077
//

If you have problems or comments...

PBIL Back to PBIL home page