(data stored in ACNUC7421 zone)

EMBL: CR954246.PE124

CR954246.PE124       Location/Qualifiers
FT   CDS_pept        complement(145329..146612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0134"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85238"
FT                   /db_xref="GOA:Q3IDF2"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDF2"
FT                   /protein_id="CAI85238.1"
FT                   /translation="MRIYYFYSNTHYALKGITVKKVVPNILVVDDSKAILIVMEAILAE
FT                   LDMSETITTCLSATKALEKVKRDINYFDAIFTDLNMPEMDGMELIRHLGELNYQGAIII
FT                   ISEMEHKVISLAANLAKQHNAHLIGNISKPVQLTQVGSLLNKVAYLNSHTLIKEPAISK
FT                   TELINALKNDEITPFYQPKICINTSKIKSAEVLARIVSNTDGSIILPARFISLAEQHDL
FT                   INEITFALFEKATSDFENIKEQLGQNLKLAFNLSPMQLNDLSCPNKLLLILKLNQLKPS
FT                   DIIIEITEQHALSSLSQLETLNRLRMHGFGLSLDDFGVGFTNMSQLKNLPFTEIKIDRT
FT                   LISNIETDQFSQVVVSSLIDITNQEHLELVAEGVERPEELAYLRHYKTRLAIQGFLFSR
FT                   PKSKSEFIDWAQYWIKVTGNTINYKPPS"
     atgagaatct actactttta tagtaataca cactatgcat tgaaagggat aacagtgaaa        60
     aaagtagtgc ctaatattct ggtcgttgat gactcaaaag ctattttaat tgtaatggaa       120
     gcaatcctcg ctgagttaga tatgtcagaa accataacca cttgcctaag tgctacaaaa       180
     gcgctagaaa aagttaaacg tgacataaac tattttgatg ccatttttac cgatttaaac       240
     atgcctgaaa tggatggcat ggagctaata cgccatttag gagagctaaa ttaccaaggc       300
     gccattatta ttatttctga aatggagcat aaggtaatta gtttagctgc caacttagcc       360
     aagcagcata atgctcacct tatcggtaat atttctaagc ccgtacaatt aactcaagta       420
     ggctccttgt taaataaagt tgcctattta aatagccaca ctttaataaa agaacctgct       480
     atttcaaaaa cagagcttat taacgcatta aaaaatgacg aaataacgcc gttttatcaa       540
     cctaaaatat gtattaatac cagtaaaata aaaagtgctg aagtattagc gcgtattgtg       600
     tcaaataccg acggtagtat aattttacca gctcgtttta ttagccttgc tgagcaacat       660
     gatctaatta acgaaattac atttgcgctc tttgaaaaag ccaccagtga tttcgaaaat       720
     ataaaagagc agctaggaca aaatttaaaa ctggcattta acttatctcc catgcagtta       780
     aacgatctta gctgcccaaa taagctatta cttatattaa aacttaacca gcttaaacct       840
     agtgatatta ttattgagat aaccgaacaa catgcgcttt caagcctaag ccaattagaa       900
     acattaaacc gcctaagaat gcatggtttt ggtttatcgc ttgacgattt tggcgttggc       960
     tttactaaca tgagccagct taaaaacttg ccctttaccg aaataaaaat agaccgcaca      1020
     cttattagta atatagaaac agatcagttt tctcaagttg ttgtaagctc cctcatcgac      1080
     attaccaatc aagagcattt agaactagta gcagaagggg ttgagcgccc cgaagagctt      1140
     gcctatttaa ggcattacaa aactcgctta gcaatacagg gatttttatt tagtcgtcct      1200
     aaatctaaga gtgaatttat agactgggca caatattgga ttaaagtgac aggaaatacc      1260
     attaactata aacccccaag ctaa                                             1284
//

If you have problems or comments...

PBIL Back to PBIL home page