(data stored in ACNUC7421 zone)

EMBL: CR954246.PE125

CR954246.PE125       Location/Qualifiers
FT   CDS_pept        146735..147751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0135"
FT                   /product="putative metalloprotease; probable metal binding
FT                   site"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85239"
FT                   /db_xref="GOA:Q3IDF1"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDF1"
FT                   /protein_id="CAI85239.1"
FT                   /translation="MIRIELKLADQPFTLMVSGQKVVQIFHSQQAITFDNPRDNYYQFT
FT                   FDNKLIGIDSSLVNEQSISLFVNDEFATQLALPAATGGETKKGWLGLAALGFKLFKSAK
FT                   VIKVVLAGASVAGYAWLFSIEFALMLIACLVVHEYGHVRAMQYFGIKTKGIYLIPFVGG
FT                   LAVSDDKITTRWQDVVISLMGPAFGLITSVLSLVLYYATEMEIFAGVAVLSALLNLFNL
FT                   LPILPLDGGHVLKSISFSMRSWVGLSVCLLGVLFGLWLSYTFGLMLLVFFLFIGALEIV
FT                   FEWRGRHTSHLMPLDKYGQGFSAVMYALVVAGHIAVMMHFADSENPILSLPMKILSS"
     atgataagaa tagaacttaa gttagccgat cagcctttta cactaatggt ttctgggcaa        60
     aaagttgtgc agatatttca tagtcaacaa gcgattactt ttgataatcc ccgcgacaac       120
     tattatcaat ttacttttga taacaaacta ataggtattg atagctcatt ggtaaatgag       180
     cagagtattt cgttgtttgt aaacgatgag tttgctacgc aacttgcttt acctgcagct       240
     actggcggtg aaactaaaaa aggctggcta ggattggccg cacttggttt taagctattt       300
     aaaagtgcca aagtaattaa ggtggtgtta gcgggagcgt cagttgccgg ctatgcctgg       360
     ttattcagta ttgagtttgc acttatgctt attgcttgct tagtggtgca tgaatacggc       420
     catgtgcgtg ccatgcaata ttttggcatt aaaaccaaag gcatttattt aattccgttt       480
     gtaggcgggc ttgcagtaag tgatgataaa attaccacgc gttggcaaga tgtagtgatt       540
     tctttaatgg gccccgcgtt tgggcttata acgtcagtat taagtttagt gttgtactac       600
     gctaccgaaa tggaaatatt tgccggtgtt gctgtgctta gcgctttact taacttattt       660
     aatttactgc ctattttacc gcttgatggt ggccatgtat taaaaagtat tagcttttct       720
     atgcgctcat gggtcggttt aagtgtgtgt ttattgggag tactgtttgg tttatggcta       780
     agttacacct ttggtttaat gttgttggtg ttctttttgt ttattggtgc gctggaaatt       840
     gtatttgaat ggcgcggcag acacacttca catttaatgc cacttgataa gtatggccaa       900
     ggtttttcag cggtgatgta tgcgctggtg gttgccgggc atatagccgt aatgatgcat       960
     tttgcagact cagaaaaccc cattttaagc ttgccaatga aaatattatc gagctaa         1017
//

If you have problems or comments...

PBIL Back to PBIL home page