(data stored in ACNUC7421 zone)

EMBL: CR954246.PE127

CR954246.PE127       Location/Qualifiers
FT   CDS_pept        149300..150370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0137"
FT                   /product="putative potassium channel"
FT                   /function="1.2.4 : Cations"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85241"
FT                   /db_xref="GOA:Q3IF32"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF32"
FT                   /protein_id="CAI85241.1"
FT                   /translation="MPVIFKRLVLLVRAHIDQLSWQAVALAILTHMLLTWGLLYIANEQ
FT                   ALTSLTTFFYYYTVTTSTVGYGDFSPTTDLGRWVVALIQIPFGLALFGVLLGKTGQTIT
FT                   YLIRRAMTGDKNFAHSSNHIIIFGWHDTRTKKMIDYILADTKRTERRILLAVTEQMEHP
FT                   FLSNESVDFVRLSSFTDLEELKRVAISYADKVIIDGQDDDQTFTTALRISRLVKDDCHI
FT                   SAHFLDETKVDMLLEHCQNVECSSVKSAEILVRSMQDPGSSRVHEELLSILHGDTQFSL
FT                   AIPEQSKEMEFGTLFHHFKHQHDAILLGVAHNLSAQNMDLNPPLDYKINAGDILHYIAV
FT                   ERVLSREVDWPALAKA"
     atgccggtga tatttaaaag gctagtgtta cttgtacggg ctcatataga tcagttgagt        60
     tggcaagcag tggcactggc tattttgact catatgcttt taacatgggg attgttatat       120
     atagcaaatg agcaagcact cacctcccta acaacctttt tttattatta cacggtaacc       180
     acttcaaccg tagggtatgg cgattttagc ccaaccacag atttagggcg ttgggtggtg       240
     gctttaatac aaataccttt tggtttagct ttatttggcg ttctgttagg caaaacaggg       300
     caaacaataa cttacttaat taggcgcgct atgactggtg ataaaaactt tgctcacagt       360
     agcaaccata ttattatttt tggttggcac gatacccgta ctaaaaaaat gattgattac       420
     attctggccg acactaaacg taccgaacgg cgtattttac ttgcagtaac tgagcaaatg       480
     gagcacccat ttttaagtaa cgaaagtgtc gactttgtgc ggttaagtag ctttaccgat       540
     ttagaggagc taaaacgtgt agctataagc tacgccgata aagtgattat tgacggccaa       600
     gacgacgatc aaacctttac taccgcattg cgcattagcc gtttagttaa agatgattgc       660
     catataagcg cgcatttttt agatgaaaca aaagtagata tgctattaga gcattgccaa       720
     aatgtagaat gcagcagtgt taaatcggca gaaatactcg tacgttcaat gcaagatcca       780
     ggttcgagcc gagtgcacga agagctacta tcaattttac atggcgatac gcagtttagc       840
     ttagccattc cagagcaaag caaagagatg gagtttggta ctttgtttca tcattttaaa       900
     catcagcatg atgctatttt acttggtgtg gcacacaatt taagtgcaca aaatatggat       960
     ttaaatccgc cacttgatta taaaattaac gccggcgaca ttttgcacta catagcagta      1020
     gagcgagtat taagtcgtga ggttgactgg ccggctttgg caaaagcatg a               1071
//

If you have problems or comments...

PBIL Back to PBIL home page