(data stored in ACNUC7421 zone)

EMBL: CR954246.PE128

CR954246.PE128       Location/Qualifiers
FT   CDS_pept        150367..150570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0138"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85242"
FT                   /db_xref="GOA:Q3IF31"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF31"
FT                   /protein_id="CAI85242.1"
FT                   /translation="MNEVIFLIILLIAYILPVVIVLNSKRTQGHEKNAWLIGIVFFSWL
FT                   GLIMYLAIVPKHGRKKRQNKKP"
     atgaacgaag ttatattttt aatcattctt ttaattgcct atattttacc tgtggttatt        60
     gtactcaata gtaagcgtac tcaaggccac gaaaaaaatg cttggttaat tggcattgta       120
     tttttttcgt ggttagggct tattatgtat ttagccatag tgcctaaaca tgggcgtaaa       180
     aaaaggcaaa ataaaaagcc ttaa                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page