(data stored in ACNUC7421 zone)

EMBL: CR954246.PE129

CR954246.PE129       Location/Qualifiers
FT   CDS_pept        complement(150651..151682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0139"
FT                   /product="conserved protein of unknown function; similar to
FT                   a protein from a plasmid"
FT                   /function="4.6.1 : Plasmid-related functions"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85243"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF30"
FT                   /protein_id="CAI85243.1"
FT                   /translation="MKLLYWLDEWLTLSCDEQQAKLPMSGGDLLGDVYVKYDFIDINKP
FT                   LLFTFSPAGTDVQEQDLHADFAPWGYHLAQKQNVNVIAFQHLGKSNWFRNRNLIFFLEQ
FT                   LSPLLTSFKTRLGYGLSRGGFAVGAFAKLLKLDQVLLFHPVSTKNKSLVPWDDRSSTDI
FT                   AQQYDWEGSYADLDLGNAQGYIIYDPTNRIDRLHAKRYKQLNHLRVFGMGHGTHATYLN
FT                   KFGFYKQVAVDFMRHQQIDIAQFRLQTKTLRFKEDYYKRLNKANKKSAHRLELLSTAHN
FT                   ILIDEKTAHVQEHQASIDIQPLIDVALKHQEQHPDDAIQLLEVAKQLAPNDPLVKHKLK
FT                   ELE"
     atgaagttac tgtattggtt agatgagtgg ttaacccttt cgtgtgatga gcagcaagcc        60
     aaactgccaa tgtctggggg agatttactt ggcgatgtat atgttaagta cgactttatt       120
     gatattaata agcctctact atttaccttt tcgcctgctg gtactgatgt gcaggagcaa       180
     gaccttcacg cagacttcgc gccctggggt tatcacctgg cacaaaaaca aaacgtaaat       240
     gtgattgcct ttcagcacct agggaaaagt aattggtttc gtaaccgcaa tttaattttt       300
     tttctggaac aattatcccc actgcttaca tcttttaaga ctcgattagg ttatggctta       360
     agccgtggtg gctttgcggt tggtgctttt gcaaaattat taaagctaga tcaggtattg       420
     ctttttcacc ctgttagcac taaaaataaa agcttagtgc catgggacga ccgctctagc       480
     acagatatag ctcagcaata tgattgggaa ggcagttatg ccgatttaga tttaggcaac       540
     gcccaaggct atattattta cgaccccact aatcgtattg atcgactaca tgccaagcgc       600
     tataagcaac ttaaccattt acgggtattt ggtatgggtc acggcactca cgccacttac       660
     ttaaacaagt ttggttttta taagcaagta gctgtggact ttatgcgcca tcaacaaatt       720
     gatattgcgc agtttcgcct gcaaactaaa accttacgct ttaaagagga ctattacaaa       780
     aggctcaata aagcgaataa aaaatcggcg catcgcctag aattactaag tactgcacat       840
     aatattttga tagacgaaaa aacagctcac gtacaggagc atcaagctag cattgatatt       900
     cagccactta ttgatgtagc gcttaaacat caagagcagc accccgatga tgccatccaa       960
     ttactcgaag tcgccaagca attagcgcca aacgaccctc ttgtgaagca caaactgaaa      1020
     gagcttgaat ag                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page