(data stored in ACNUC7421 zone)

EMBL: CR954246.PE130

CR954246.PE130       Location/Qualifiers
FT   CDS_pept        complement(151869..152330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0140"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85244"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF29"
FT                   /protein_id="CAI85244.1"
FT                   /translation="MAYWLFKTEPDAFSIDDLKNAQNQTTLWEGVRNYQARNFMRDEVK
FT                   VGDLVMIYHSSCKLVGVVGIAVVTKAAYQDPTQFDLSSDYYDAKATSDNPRWVVVEVTY
FT                   QSHLDSLVSLKEIKANPRITDIALKKGGRLSIMPVTKSDWQIITHMAEE"
     atggcgtatt ggctatttaa aactgaaccc gatgcatttt cgattgacga tcttaaaaat        60
     gcacaaaatc aaaccacact ttgggaaggg gtacgtaatt accaagcacg taactttatg       120
     cgcgacgagg taaaagtagg tgacctcgta atgatttacc attctagctg caagctcgta       180
     ggcgtagtag gtattgctgt agtaacaaaa gcagcttacc aagatccaac tcagtttgat       240
     ttaagtagtg attattatga tgctaaagcc accagcgaca atcctcgctg ggtagtagta       300
     gaagtaactt atcaatctca tttagactct ctggttagct taaaagaaat aaaagctaac       360
     cctcgcatca ccgacatagc gcttaaaaaa ggcgggcgat tgtcaataat gcccgtaacc       420
     aaaagtgatt ggcaaataat cacccacatg gctgaggagt aa                          462
//

If you have problems or comments...

PBIL Back to PBIL home page