(data stored in ACNUC7421 zone)

EMBL: CR954246.PE14

CR954246.PE14        Location/Qualifiers
FT   CDS_pept        18379..19020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0014"
FT                   /product="conserved protein of unknown function, putative
FT                   GTP-binding domain"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85128"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ20"
FT                   /protein_id="CAI85128.1"
FT                   /translation="MVYNLVHQRMSEYKYPAADVFHQEEIKKSTFIVHIAHTPDLSSAK
FT                   AFIKSIETKYADARHNCWAHVAGKPGGSHVYGFSDDGEPNGTAGKPMLNVLMGSGLGEV
FT                   TAVVTRYFGGIKLGTGGLVRAYGGTLNNALANLSTINKVPSIELIGSSEYSMQGVIEQL
FT                   LKTKYQVLNIDKQFTANIEWVITIDSRQATQAIKDIFDLSHGAVELTIKE"
     ttggtttata acttggttca tcaacgaatg tcagaatata aatacccagc agcagatgtt        60
     tttcatcaag aagagattaa aaaaagcacc tttattgtgc atattgcaca taccccagat       120
     ttaagttcag ctaaagcgtt tataaaaagt attgaaacta agtatgccga tgcacggcat       180
     aattgctggg ctcacgtagc gggtaaacca ggaggaagcc atgtgtatgg gttttcggat       240
     gatggtgagc caaatggcac cgccggtaaa cctatgttaa atgtgcttat gggctcaggg       300
     cttggtgaag ttaccgctgt ggttacgcgt tattttggtg gtataaagct aggtacaggc       360
     ggtttagtac gtgcttatgg aggcacatta aataatgcat tagctaactt atcaacgata       420
     aataaagtgc caagtattga gctaattggt agtagtgaat acagtatgca aggcgttatt       480
     gagcaactat taaaaacgaa gtatcaagtg cttaacatcg ataagcaatt tactgctaat       540
     attgaatggg ttattactat tgatagccgc caagcgacgc aagcaattaa agatattttt       600
     gatttaagcc acggcgcggt tgagttaacc attaaagagt aa                          642
//

If you have problems or comments...

PBIL Back to PBIL home page