(data stored in ACNUC7421 zone)

EMBL: CR954246.PE147

CR954246.PE147       Location/Qualifiers
FT   CDS_pept        166112..166615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0157"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85261"
FT                   /db_xref="GOA:Q3IFL9"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFL9"
FT                   /protein_id="CAI85261.1"
FT                   /translation="MKYFTYLAVSVMIIAVISLFYLKKPNGETWLSTSVVINESQQIKD
FT                   KIISFTSNTFEQAVSSVSNTPSTTRSKIFKWQDRQGQWHFSDTPHPNGKSVEVKLDPKD
FT                   INVVVAQDTAILSGSSKSSAVNSTSATPTVYDPVSIKKVFDDAEKAKQKLEQRTKQLND
FT                   LNGF"
     atgaaatact ttacctattt agcagtgtca gtaatgatta ttgctgttat ttctctgttt        60
     tatttaaaaa agccaaacgg agaaacatgg cttagtacat ctgttgtgat caacgaatct       120
     cagcaaatta aagataaaat aatctcgttt accagcaata cgtttgagca agccgttagt       180
     agcgtgtcga acacaccctc aacaacccgc agtaaaatat ttaagtggca agatcggcaa       240
     ggccaatggc atttttcaga tacgcctcac cctaatggta aaagtgttga agtaaaacta       300
     gaccctaaag atattaacgt ggtggttgcc caagatacgg ctattttatc gggcagttcc       360
     aaatcctcag cagtaaatag cacttcagct acacctacag tttatgatcc agtatcaatt       420
     aaaaaggtgt ttgatgacgc tgaaaaagca aaacaaaaat tagagcaacg tactaaacaa       480
     ttaaatgatt taaacggttt ttaa                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page