(data stored in ACNUC7421 zone)

EMBL: CR954246.PE148

CR954246.PE148       Location/Qualifiers
FT   CDS_pept        complement(166644..166895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0158"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85262"
FT                   /db_xref="GOA:Q3IFL8"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFL8"
FT                   /protein_id="CAI85262.1"
FT                   /translation="MSQIIIIRLLKISIVLGLCLIVTGHALIVSSYFTRQHGINGIIIA
FT                   AACIAIGVLLSLPTKIYLTILLMEAEKRYLKAHSHKHK"
     atgtcacaaa tcataattat taggctactt aaaatatcaa ttgtacttgg gttatgccta        60
     attgtgactg gtcatgcgtt aattgtatca agctacttta ctcgccagca tggtattaac       120
     ggcataatta tagcggcagc ctgcattgct attggcgtat tattatcgtt acccactaaa       180
     atttatttaa ctattttact tatggaagca gaaaagcgtt atttaaaagc gcatagccat       240
     aaacacaaat aa                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page