(data stored in ACNUC7421 zone)

EMBL: CR954246.PE150

CR954246.PE150       Location/Qualifiers
FT   CDS_pept        complement(169968..170402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0160"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85264"
FT                   /db_xref="GOA:Q3IFL6"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFL6"
FT                   /protein_id="CAI85264.1"
FT                   /translation="MLAHPPPKWLKPLAWVALIWNLCGVIAFALQMLMTPEVISKMPID
FT                   QQAAYSNIPVWSTIAFAIAVFGGTLGSALLLAKKSFALPVFTVSLMAILIQQYYNFIVI
FT                   NSVEIMGSSAVFMPLFVVVIAILLLCVSFKGKQQGWLYAN"
     atgcttgcac acccccctcc taagtggtta aaaccactcg catgggtagc gcttatatgg        60
     aacttatgcg gcgttattgc cttcgcacta caaatgctga tgacacctga agtaattagc       120
     aaaatgccta tagatcagca agctgcatat tctaacattc ccgtttggtc aaccattgca       180
     tttgctattg cagtctttgg cggcacgctt ggcagtgctt tattgctcgc taaaaagtca       240
     tttgcactgc ccgtatttac cgtgtcgtta atggctattt taatccaaca gtattacaat       300
     tttattgtta ttaacagcgt tgaaataatg ggatctagtg cggtatttat gccactgttt       360
     gtggtagtaa ttgccatatt gctactttgc gttagcttta aaggcaaaca gcaaggctgg       420
     ttgtatgcaa attaa                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page