(data stored in ACNUC7421 zone)

EMBL: CR954246.PE151

CR954246.PE151       Location/Qualifiers
FT   CDS_pept        complement(170509..170892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0161"
FT                   /product="conserved protein of unknown function, similar to
FT                   putative regulator YbcJ from E. coli K12, could bind
FT                   nucleic acids"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85265"
FT                   /db_xref="GOA:Q3IFL5"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFL5"
FT                   /protein_id="CAI85265.1"
FT                   /translation="MNEEYIEIELEEEPIELCKLLKVLNLVEGGGQAKNLIAEGYVGVN
FT                   HEICTIKRKKLYSGDILEFDGELFQLALTEDATPVERPAEQPQSEPSQAAPQPASQPAK
FT                   NKRKRTKKPKVDEKTGRRPISFG"
     atgaacgaag aatatataga aattgaatta gaagaagagc cgattgagct gtgtaaatta        60
     ttaaaagtac taaatttagt agaaggcggc ggccaagcaa aaaacttaat tgctgaaggt       120
     tatgtgggtg ttaaccatga aatttgtaca attaaacgga aaaaactata cagtggcgac       180
     atactagaat ttgatggtga gctttttcaa cttgcattaa ccgaagatgc aacaccggta       240
     gagcgacctg ccgagcagcc gcaatctgag ccaagccaag cagcaccgca gccagcgagt       300
     cagcctgcaa aaaataaacg taagcgtact aaaaaaccta aagtagatga aaaaaccggt       360
     cgtcgcccta tttcattcgg ttaa                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page