(data stored in ACNUC7421 zone)

EMBL: CR954246.PE152

CR954246.PE152       Location/Qualifiers
FT   CDS_pept        complement(170972..171430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0162"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85266"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFL4"
FT                   /protein_id="CAI85266.1"
FT                   /translation="MKLIENIPLFKQMEIINRLGFFKEFSLNERQILLESFGLLYLVRE
FT                   NSFLFKQHDNDKRLFIVLSGALIVFKHNHLLELGTIRPGEFIGEGAFINNRARSISARA
FT                   KTDAIVLAITSDALTRLPNVIREKIKDRIIEGMSLRIAKLSEHIENHG"
     atgaagttaa tagagaacat tccgctattt aaacagatgg aaattatcaa ccgtttagga        60
     ttttttaaag aatttagcct taacgagcgc caaatacttt tagagtcgtt tggtttatta       120
     tatttagtgc gcgaaaattc atttttattt aaacagcacg acaacgataa gcgcctattt       180
     atagtactta gcggtgcatt aatagtgttt aagcacaacc atttattaga gctcggtact       240
     atacgtcctg gggagtttat tggtgaaggc gcttttatta ataaccgcgc acgcagcatt       300
     agcgcacgtg ctaaaacgga tgcaattgtg cttgctatta cctctgatgc ccttactcgc       360
     ttacccaatg taatacgcga aaaaattaaa gatagaataa ttgaaggtat gagcttacgt       420
     attgccaagt tgagcgaaca catagaaaac catggttag                              459
//

If you have problems or comments...

PBIL Back to PBIL home page