(data stored in ACNUC7421 zone)

EMBL: CR954246.PE155

CR954246.PE155       Location/Qualifiers
FT   CDS_pept        complement(174025..174570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0165"
FT                   /product="conserved protein of unknown function ; putative
FT                   secreted protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85269"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFL1"
FT                   /protein_id="CAI85269.1"
FT                   /translation="MLKMQGCRVSSKILLLLITSLLSVCSYAGEKKIYAWKDKNGVLVF
FT                   SDTPHIGAKEIKLTSQDLTMPATNTDILNNQTKAQPVAFSIGIASPEHQQTIRENTGSV
FT                   YVSTRITPRFENDFTIQLLLDGKAYGAASDTSTFALRDVERGEHTLQVKLYNKQNQVIA
FT                   TSPLSVFFMHRKGLSLGN"
     atgttaaaaa tgcagggttg cagagtgagt agcaagattt tattactact aattacttca        60
     ttattaagtg tttgtagtta cgctggtgaa aaaaaaattt acgcatggaa agataaaaat       120
     ggcgtactgg tgttttcaga taccccccat attggcgcca aagagataaa actcaccagc       180
     caagatttaa ccatgcctgc aacaaataca gatatattaa ataatcaaac taaagcgcag       240
     ccggttgcat ttagtattgg tattgcatcg cctgagcatc agcaaactat tcgtgaaaac       300
     accggctctg tgtatgtatc tactcgcatt accccccgct ttgaaaacga ctttacaata       360
     cagctattgc ttgatggtaa agcctatggc gcagcaagtg atacctcaac ttttgcttta       420
     agagatgtag agcgtggtga gcacactctg caagttaagc tgtacaacaa acaaaaccaa       480
     gtcattgcga caagcccatt gagtgtattt tttatgcata gaaaaggctt aagcttaggt       540
     aattaa                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page