(data stored in ACNUC7421 zone)

EMBL: CR954246.PE158

CR954246.PE158       Location/Qualifiers
FT   CDS_pept        complement(178735..179814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0169"
FT                   /product="putative hydrolase"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85272"
FT                   /db_xref="GOA:Q3IFK8"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFK8"
FT                   /protein_id="CAI85272.1"
FT                   /translation="MKHITLIIFISCFLSACSTPNQVQKIADKNSVIAVNNQTGRYHNL
FT                   YQGKKVYPTTCEQNCYPPHPNLICETPSSNCQYQGKQIKPPLNTGYTVRWLGHASFVVS
FT                   TRNGQNVLFDPVSEQFDSPVDLGFKLAGGFYRKPGAWPNKQTLENINAVMYSHIHYDHF
FT                   NKADIKKLGNQPRYLAPLGMADNFPTGGFNITEMAWYAKTSIEDLTIHAVPAHHFSNRV
FT                   LIPYIYEDDNKDSWNGWLLEQNGSTLFFAGDTGYSKHFKDIQQKYGDIDLCLMPIASYY
FT                   HKTNAKGYRYVHTTPEDALNAATELNCKVMIPWGYGNSSWQMGDHSSHSALSRLLHMYK
FT                   QMNAPVPLYILNEGETIKL"
     atgaaacaca ttacccttat aatctttata agctgttttt tatcagcgtg tagtacacct        60
     aaccaggtgc aaaaaatagc tgataaaaac tcagttattg ctgttaacaa ccaaacaggt       120
     cgttaccata atttatatca aggcaaaaag gtttacccaa ccacctgcga gcaaaactgc       180
     tacccgccac atccgaactt gatttgcgaa acacccagca gcaactgcca gtatcaaggt       240
     aagcaaatta agccgccgct caataccggt tatacggttc gttggttagg gcatgccagc       300
     tttgtggtca gcacacgtaa tgggcaaaat gtattatttg atccggttag tgagcagttt       360
     gattcaccgg ttgatttagg ctttaagctt gcaggtgggt tttatcgcaa acccggagca       420
     tggccaaata agcaaacact tgaaaacatt aacgccgtta tgtattcgca tattcattat       480
     gatcacttta ataaagcaga tattaaaaaa ctgggtaatc aaccacgtta tttagccccg       540
     ctaggcatgg cagataactt cccaacgggt ggctttaata ttactgaaat ggcgtggtat       600
     gcaaaaacca gcattgagga cttaaccata cacgcagtgc ctgcacatca ctttagtaat       660
     cgggtgctta ttccctatat ttacgaagat gataataaag attcttggaa tggctggctg       720
     cttgaacaaa atggcagcac cttatttttt gccggcgata ctggctattc aaaacacttt       780
     aaagacatac aacaaaaata cggtgatata gacctatgcc taatgccaat tgcctcttat       840
     taccataaaa ccaacgctaa agggtatcga tacgttcata ctacgccaga ggatgccctt       900
     aatgcggcca cagagcttaa ttgcaaagta atgataccat gggggtatgg caactcaagt       960
     tggcaaatgg gcgatcacag cagccactca gcgctatcgc gcttactgca tatgtataaa      1020
     caaatgaatg caccagtacc gctgtatatt ttaaatgaag gcgaaacaat taaactttaa      1080
//

If you have problems or comments...

PBIL Back to PBIL home page