(data stored in ACNUC7421 zone)

EMBL: CR954246.PE159

CR954246.PE159       Location/Qualifiers
FT   CDS_pept        complement(179907..180563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0170"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85273"
FT                   /db_xref="InterPro:IPR021342"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ36"
FT                   /protein_id="CAI85273.1"
FT                   /translation="MKKQTLLSVTVLALVLTLSGCQSAYYSAMEKVGVHKRDILIDRVE
FT                   ETKDSQQESQEEFKSALERLTTLIDFNGGELQDTYNQLNDDYESSLNAANEVSTNINKV
FT                   EDVAEALFDEWSDELEQYKSASLKRESSKKLAATKRQFDQLLRSMRSAESKMEPVLTSL
FT                   HDNVLYLKHNLNAQAVSAIKGEFTNLKRDIQLLMNDMNKSIADSNKFIEQMNSAG"
     atgaaaaaac aaacattact gagtgttacc gtacttgcac ttgtactaac attatcgggt        60
     tgccagtcgg cttattactc ggccatggaa aaggtaggcg tacacaagcg cgatattctt       120
     attgaccgcg tagaagaaac caaagactcg caacaagagt ctcaagaaga gtttaaatca       180
     gcgcttgagc gcttaactac acttattgat tttaatggtg gcgaactgca agacacttac       240
     aatcagttaa acgatgacta tgagtcgagc ttaaatgccg ctaacgaagt gtcaactaac       300
     atcaataaag tagaagacgt agcagaagcc ttatttgatg agtggagcga tgagctagag       360
     caatataaaa gcgcatcact taaacgtgaa agcagtaaaa agctagccgc gactaagcgt       420
     caatttgatc agctattacg ctcaatgcgc agtgcagaga gcaaaatgga gccggtatta       480
     acatcgcttc atgataacgt tttatactta aagcataact taaacgcaca agcggtatcg       540
     gctattaaag gcgagttcac taaccttaaa cgcgatatac aattgcttat gaacgacatg       600
     aacaaatcga ttgccgactc aaataaattt attgaacaaa tgaatagtgc cggttaa          657
//

If you have problems or comments...

PBIL Back to PBIL home page