(data stored in ACNUC7421 zone)

EMBL: CR954246.PE16

CR954246.PE16        Location/Qualifiers
FT   CDS_pept        20561..21232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0016"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85130"
FT                   /db_xref="GOA:Q3IDH6"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR009926"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDH6"
FT                   /protein_id="CAI85130.1"
FT                   /translation="MPTTNLEKLHQIMSGAMVDLEILTPTASKRVKTEFIGLLENRFII
FT                   LNYPSSKRLPTASDYLHDGVMVVVRALIEGSGGQVIAFRQQIMSVASHPARLLFINYPK
FT                   QVQLFDLRSQTRIPTLLSAKLKLSDDRILDGVIKDISLTGVKFDLKDKTQAENIKGMQC
FT                   SIILDSSNKQVKDFQGEICSVKEHVQGAYCGIKLLASEEEMKSFMGDHFIDPSILQSET
FT                   E"
     atgccaacaa ctaacctaga aaagttacac caaataatgt ctggtgccat ggttgatctt        60
     gaaattttaa caccaacagc cagcaagcgt gtaaaaacag agtttatagg tttgctcgaa       120
     aatcgattta ttattttaaa ctatccgagc tcaaagcgcc tgcctacagc aagcgactac       180
     ctgcacgatg gggtaatggt ggtagtaaga gcactaatag agggaagtgg tgggcaggtt       240
     atcgcttttc gtcagcaaat aatgtcagtt gcatctcatc ccgcacgctt actttttatt       300
     aattacccaa agcaagtgca gttattcgat ttacgctcgc aaactcgtat acctacttta       360
     ttatcggcca agctaaaact tagtgatgac aggatactcg acggggtaat taaagatatt       420
     tcgctaacgg gcgtaaagtt tgatcttaaa gacaaaaccc aggctgaaaa tattaaaggg       480
     atgcaatgct caatcatcct cgatagtagt aataagcaag ttaaagactt tcagggagaa       540
     atttgtagcg tgaaagaaca cgttcaaggt gcttactgtg gaataaagct attagccagc       600
     gaagaagaaa tgaaaagctt tatgggggat cactttattg acccttcaat actccaatca       660
     gaaaccgagt aa                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page