(data stored in ACNUC7421 zone)

EMBL: CR954246.PE162

CR954246.PE162       Location/Qualifiers
FT   CDS_pept        complement(181976..182704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0173"
FT                   /product="conserved protein of unknown function; some
FT                   similarity with spermidine synthase (could be an
FT                   aminopropyltransferase)"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0173"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85276"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ41"
FT                   /protein_id="CAI85276.1"
FT                   /translation="MLGNMSEYINPVNGLINSYFIENSHSIGQLLYWHKYGGDHIQVRQ
FT                   HQQLRWLLINDTLQSVVTQQQPSNLLLPHLQCLAQHWHTLSTPKKVLELGLGGGAIRNY
FT                   LLHQYPHAKITSAEINADIISCYKKFFTTQQVPNNNTQRLLCEDAQQVLARARNIDWII
FT                   LDLFSQIDAPRFLFAPAFYQKIHAALNNNGTLFINFLSQHESQLKQLQQVLLNVFGYKV
FT                   SPQKVAGYINHIVVITKQLN"
     atgctgggca acatgagcga atacataaac cctgtaaatg gcctgattaa tagctatttt        60
     attgaaaata gccacagtat tggccagtta ctttattggc ataaatatgg gggcgatcac       120
     attcaagtac gccaacatca gcaactgcgt tggctgctaa taaatgacac tctgcaatct       180
     gtggtaacgc agcagcaacc aagcaattta ttactgccac acttacagtg cttagcacag       240
     cattggcaca cattaagtac ccctaaaaaa gtactcgaac tggggcttgg cggcggcgca       300
     attcgtaatt atttgctgca ccaatatcca cacgcaaaaa tcacctcagc tgaaataaat       360
     gcagatataa ttagttgtta taaaaagttt tttactacgc agcaagtgcc taataataat       420
     acacagcggt tactttgtga ggatgctcag caagtactgg cgcgcgcccg caacatagat       480
     tggattattt tagatttatt tagccaaata gacgcaccac gatttttatt cgcacccgct       540
     ttttatcaaa aaatacacgc agcccttaac aacaacggca cgctatttat taatttttta       600
     tcgcaacatg agtcgcaatt aaaacagtta cagcaagtat tacttaatgt atttggttat       660
     aaagttagcc cgcaaaaggt agcaggctat ataaatcata ttgtggtgat cactaaacag       720
     ctaaattaa                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page