(data stored in ACNUC7421 zone)

EMBL: CR954246.PE163

CR954246.PE163       Location/Qualifiers
FT   CDS_pept        182867..183760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0174"
FT                   /product="putative acyltransferase"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85277"
FT                   /db_xref="GOA:Q3IJ40"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012660"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ40"
FT                   /protein_id="CAI85277.1"
FT                   /translation="MFQVSTPQSSEDWQAYYQLRWEILRAPWGEPRGSEQDDLEQDAEH
FT                   RFIKNKAGKVLGVARLHFNNQQQAQVRYMAVAEESRNQHIGSRLLHDLEKIAWSQDAAE
FT                   LVLFARERALEFYKRHGYETQEKAHLAYGDVQHYKMVKQKPSEPGWFRHPNWTQVLQNT
FT                   WRESIPISDAMGIKVESYTDWQFTTSADLDANLNLHNTMFAGSIYSLATLTGWGATYLA
FT                   LKEAGLEGNIVLADANIKYLKPLSSDPRGCVDIQSCKGKLSELETEGKASYLVPVIIYD
FT                   GDKVVAEFEGQFVVKK"
     atgtttcagg taagtacacc gcaaagtagt gaagattggc aagcctatta tcaattacgt        60
     tgggaaattt tacgtgcccc ttggggtgag ccacgtggtt ctgaacagga tgatttagaa       120
     caagatgccg agcatcgctt tattaaaaat aaagcgggta aagtattagg ggtggcgcgg       180
     ctgcacttta ataaccagca acaagctcaa gttcgctata tggctgtagc tgaagaaagt       240
     cgtaatcagc atattggtag tcgtttatta catgacctag aaaaaatagc atggtcacaa       300
     gacgctgcag agttggtgtt atttgcacgc gagcgcgcac tcgaatttta taagcgccat       360
     ggttatgaaa cacaagaaaa agcgcattta gcgtacggcg atgtacaaca ctataaaatg       420
     gtaaaacaaa agccatcaga gccaggctgg tttcgccacc ctaactggac tcaagtgctg       480
     caaaacacct ggcgtgagtc aattccaatt agtgatgcaa tgggcattaa agtagagagc       540
     tataccgact ggcaatttac gactagcgca gatttagatg ctaatttaaa cctgcataac       600
     actatgtttg ctggttctat ttatagctta gcaaccctta cggggtgggg cgcaacctac       660
     ttagcactaa aagaagcagg gcttgaagga aatattgtat tagccgatgc caatattaaa       720
     tatttaaaac cgcttagcag tgatccacgc ggctgtgttg atatacaaag ctgtaagggt       780
     aagctcagcg agttagaaac tgaaggtaaa gccagctatt tagtgcccgt tattatttat       840
     gatggtgata aggtagtggc tgaatttgaa gggcagtttg tagtaaaaaa ataa             894
//

If you have problems or comments...

PBIL Back to PBIL home page