(data stored in ACNUC7421 zone)

EMBL: CR954246.PE166

CR954246.PE166       Location/Qualifiers
FT   CDS_pept        complement(185078..186196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0177"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85280"
FT                   /db_xref="GOA:Q3IJ37"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ37"
FT                   /protein_id="CAI85280.1"
FT                   /translation="MIASPISQENIVVGEVANGLPLTIPVYRLKGDGTGPSVYIQANMH
FT                   GAEVQGNAVIFQLLEQLKHLNLKGDITLVPYANPIGCNQKSGEFTLGRFDPITGTNWNR
FT                   MYHYNTDLVTQFAQNHMQYDDAILKSAFKQALIDEVDSKLNGPAYLLNTGKRIALNLQK
FT                   LAHQADIVLDLHTGPISSKHLYCPTYATNSARYFNIEHVLLISSDFDGAMDEANFCPWW
FT                   HLSEALSKQGRELSIPVEAFTVELGSQEKIDLSEALNDANSILSYLNYKAVFVNAPHTP
FT                   ANITRYACHLNDYFAYYAPMGGMVEYIAPLGGHIKAGEPIAKILRMERYLSEQPLQTLS
FT                   LESDAIAILHFASASVNQGTELYKFFTNVFEL"
     atgatcgcct caccaattag tcaagaaaac atcgtcgttg gtgaagttgc caatggctta        60
     ccactcacta ttcctgtgta tcgtttaaaa ggcgatggca cggggccaag tgtgtatatt       120
     caggccaaca tgcacggagc tgaagtacaa ggtaacgcgg taatttttca actacttgaa       180
     caattaaagc accttaatct taaaggtgat attactttag tgccctatgc caaccctatt       240
     ggttgcaatc aaaagtcggg ggagtttacc ctaggtcggt tcgaccctat caccggcact       300
     aattggaata ggatgtatca ttataatact gatttagtca ctcagtttgc acaaaaccat       360
     atgcaatacg acgatgccat attaaaaagc gcgttcaaac aggcacttat tgacgaagtt       420
     gacagtaaac ttaatggccc tgcttattta ctcaatactg gtaaacgcat tgcgcttaac       480
     ttacaaaagc tcgctcacca agctgatata gtactggatt tacacacagg tcctatttca       540
     agcaagcact tgtactgccc aacctatgcg actaatagcg ctcgctactt taatattgag       600
     cacgtactgc ttatttcaag tgactttgat ggtgcgatgg atgaggcaaa cttttgtccg       660
     tggtggcatt taagcgaagc actgagcaag caaggccgcg agctcagcat acctgtagaa       720
     gcttttactg tagagctagg cagccaagaa aaaatagact tgagcgaagc actaaacgat       780
     gcaaacagta ttttaagtta cttaaattat aaagccgtat ttgtaaatgc gccccacact       840
     ccagctaaca ttactcgcta cgcgtgtcat ttaaacgatt actttgctta ctacgcgccc       900
     atgggcggaa tggttgagta tattgccccc ctaggcgggc atataaaagc cggtgagcca       960
     attgctaaaa tactgcgcat ggagcgttat ttaagtgaac aaccactaca aacactttcc      1020
     cttgaatctg acgctattgc catactgcat tttgcctcgg cgagcgttaa tcaaggcact      1080
     gaactgtata agttttttac taacgtattt gagctttaa                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page