(data stored in ACNUC7421 zone)

EMBL: CR954246.PE170

CR954246.PE170       Location/Qualifiers
FT   CDS_pept        189645..190343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0181"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0181"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85284"
FT                   /db_xref="GOA:Q3IJ33"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ33"
FT                   /protein_id="CAI85284.1"
FT                   /translation="MEKFNDIYQRAVERKGSTQMLQQLLAKPASKRQLVALSDDDWLEE
FT                   FTRKVFQSGFYWSVINSKWAGFREVFWQFSVEKLLMMPPDMLEQKASDERIVRNYKKVK
FT                   TIPENAFMIHEVTQQHGSFSQFIADWPSEDIIGLWAYLKKHGARLGGNTGPYTLRALGK
FT                   DTFLLSRDVESYLRAHKIIDGGLQTKKSLTAAQAFFNELQQQSGLSMQELSLIIAYSVG
FT                   DNRVGISQQQ"
     atggaaaaat ttaatgatat ttatcagcga gcagtagagc gaaaaggctc aacacaaatg        60
     ctacagcaat tactcgctaa acctgcatct aagcgacaat tagtagcttt aagtgatgat       120
     gattggctgg aagagtttac gcgcaaggtt tttcaaagtg gtttttactg gtcggttatt       180
     aacagcaagt gggcaggctt tagagaggtt ttttggcagt ttagcgttga aaaattatta       240
     atgatgccac ccgatatgtt ggagcaaaaa gccagcgacg agcgcattgt tcgtaattat       300
     aaaaaagtaa aaacgatccc cgaaaatgcg ttcatgatcc atgaggttac ccagcaacat       360
     ggtagcttta gtcagtttat tgcagactgg ccaagtgaag atattattgg tttgtgggcg       420
     tacttaaaaa aacacggtgc acgcttgggt ggaaataccg gcccttatac tttgcgtgca       480
     ttgggtaaag acaccttttt attatcgcgg gatgttgaga gttatttgcg cgcgcataaa       540
     attattgatg gtggcttaca aactaaaaag tcgttaactg cagcgcaagc gttctttaat       600
     gaattacagc aacaaagcgg tttgagcatg caagagctaa gcttaattat agcctacagt       660
     gtaggcgata atcgtgtagg tataagccaa caacagtag                              699
//

If you have problems or comments...

PBIL Back to PBIL home page