(data stored in ACNUC7421 zone)

EMBL: CR954246.PE171

CR954246.PE171       Location/Qualifiers
FT   CDS_pept        190353..191762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0182"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85285"
FT                   /db_xref="GOA:Q3IJ32"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IJ32"
FT                   /protein_id="CAI85285.1"
FT                   /translation="MNLMPRYRQVADNFAIEDRPSKVAAPQLLLWNDSLAKAFNINVVP
FT                   ELRASTFSGNEQQAIAAVALGYSGHQFGHFSPRLGDGRAHLLGAVEDAQNQLWDIQLKG
FT                   SGATPYSRGGDGRCALGPAIREYIMSEAMQALGIKTTRCLAVVGSGETVYRNPPQPGAI
FT                   VTRLASSHIRVGSFQYLATQGDVAGLKNLADLAIERHYPKIQATGPERYLAFLAAVIKN
FT                   QVELVVSWMRVGFIHGVMNTDNTLVSGETIDYGPCAMMNSFDFDTVFSSIDKQGRYAFG
FT                   NQPNIANWNCARLAESLIPLVNDDDEQAVALMTPIIDGFAEQFNVEFSAMWATKLGLAG
FT                   TDTADKELIAELLQLLKEHQLDYTNTFDALTESLTGGMSIPEVLVQWAGKWQKRTDDRS
FT                   YTVMRAANPRVIPRNHVIEKILSEYNKTGSSELLHEFMQVMHTPYENTDKLAKFQDAPS
FT                   SDKEYYTFCGT"
     atgaatttaa tgccaaggta cagacaagta gccgacaatt ttgcaattga agatcgccca        60
     tctaaggtgg ccgccccaca gctattacta tggaacgaca gcttagctaa agcgtttaat       120
     attaatgtag ttcctgaatt acgggccagt acttttagcg gcaacgaaca gcaagcaatt       180
     gcagcggttg cactgggata ctcagggcat caatttggac atttttcacc acgtttaggc       240
     gacgggcgtg ctcatttgct aggtgcagta gaggatgcgc aaaaccagtt gtgggacatt       300
     caattaaaag gctctggtgc cactccttac tctcgtggtg gcgatggccg ctgtgcactt       360
     ggcccagcaa ttcgtgaata tataatgagc gaagcaatgc aagcgttagg tattaaaact       420
     acgcgctgct tagctgtggt tggtagtggc gaaaccgtgt acagaaaccc acctcaacct       480
     ggcgctattg taacgcgctt agccagtagc catattcgtg ttggctcgtt tcagtattta       540
     gcaacgcaag gcgacgttgc agggcttaaa aaccttgccg acttagctat tgagcgtcat       600
     tacccaaaaa ttcaagcaac aggacctgag cgctatttag catttttagc tgcagtgatt       660
     aaaaaccaag ttgagctggt ggttagttgg atgcgagtag gctttataca tggggtaatg       720
     aataccgata atacgctggt tagcggcgaa actatcgact atggcccatg tgccatgatg       780
     aacagcttcg attttgatac cgtgtttagc tctattgata agcaagggcg ttatgcattt       840
     ggtaatcaac ctaatattgc taactggaac tgcgcccgct tagctgagag tttaataccg       900
     cttgtaaatg atgacgacga acaagctgtg gcgttaatga ccccaataat agatggtttt       960
     gctgagcaat ttaatgttga atttagtgca atgtgggcaa caaaactggg cttagctggc      1020
     acagatacag ccgataaaga gttaattgca gagctattac agttattaaa agagcaccaa      1080
     ctcgactata ccaacacgtt tgatgcacta accgagtctt taacaggtgg aatgagcata      1140
     ccagaggtat tagttcagtg ggccggtaag tggcaaaaac gtaccgatga tcgcagctat      1200
     accgtaatgc gggcagctaa tccgcgagtt attcctcgta accatgtgat cgaaaaaata      1260
     cttagtgagt ataataagac tggctcaagt gaattactgc atgagtttat gcaggttatg      1320
     cacacacctt atgaaaatac agacaaattg gcaaaatttc aggatgcacc tagcagcgat      1380
     aaagagtatt atactttttg tggtacttaa                                       1410
//

If you have problems or comments...

PBIL Back to PBIL home page