(data stored in ACNUC7421 zone)

EMBL: CR954246.PE172

CR954246.PE172       Location/Qualifiers
FT   CDS_pept        192148..193212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0183"
FT                   /product="putative outer membrane protein; signal peptide"
FT                   /function="1.2.6 : Porins"
FT                   /function="1.1.3 : Surface structures (S-layers?)"
FT                   /function="1.9.1 : Biofim formation"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 12220987; Product type m : membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0183"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85286"
FT                   /db_xref="GOA:Q3IJ31"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ31"
FT                   /protein_id="CAI85286.1"
FT                   /translation="MKLKSLTIAIALAATSASAFAAEKTEGFYIGVFGDYYDASWKNLN
FT                   MHQNLEVNESASWGAEVGYRFSDYWSARLEYADMDFNAFLKNPIPNGNRNDVDGERFGV
FT                   DALYHFGGGPFYGLFGIKEVKVATDNTFLNAGVGYQHFITDGLFVNAETSVYQGLDRGY
FT                   TDVNAKLGINYLFGQSSVAEEPVQPAPEPVIVEVAPVDSDNDNIPDADDQCPNTPMTDA
FT                   VDGTGCTLYEDKEVTVSLLVTFPNNTSAVSTQYLNDIDKVAEFLKEYPDTTVLLEGHTS
FT                   SVGKASYNKWLSKKRADAVAKKLVADGVAEDRITTVGLGEERLKNEANTKAAHEENRRV
FT                   EAHIKTIKNVKVLR"
     atgaaattaa aatcacttac aatcgcaatc gcgttagctg caactagcgc atcagcattt        60
     gcagcagaaa aaactgaagg tttttacatt ggtgtgttcg gtgactatta cgatgcatct       120
     tggaaaaact taaacatgca ccaaaacttg gaagttaatg aatctgcaag ttggggtgct       180
     gaagttggct accgtttcag tgattactgg agtgcacgtc ttgagtatgc agatatggac       240
     tttaatgcat ttcttaaaaa tccgattcct aatggtaatc gtaacgacgt agacggcgag       300
     cgttttggtg ttgatgcact ttaccacttt ggtggcggtc ctttctatgg tttatttggt       360
     attaaagaag taaaagtagc aacagataat actttcttaa acgcaggtgt tggttaccag       420
     cacttcatta cagacggctt atttgttaac gcagaaacat ctgtttatca aggtcttgac       480
     cgtggttata ccgatgtgaa cgctaaacta ggtattaact acttatttgg tcaaagttca       540
     gtagcagaag agccagttca accagctcca gagccagtaa ttgttgaagt tgcaccagta       600
     gatagcgaca acgataacat tccagatgca gatgatcagt gtcctaacac accaatgaca       660
     gatgcagttg atggcacagg ttgtacttta tacgaagata aagaagtaac tgtaagctta       720
     ttagtgactt tccctaataa tacatctgca gtatctacac agtacttaaa cgatatcgat       780
     aaagtagctg agttcttaaa agagtaccca gatacaactg ttcttttaga aggtcatact       840
     tcttctgtag gtaaagcatc ttacaacaag tggttatcta aaaaacgtgc tgacgcagta       900
     gctaaaaaat tagtagctga tggcgtagca gaagaccgta ttactacagt tggtttaggt       960
     gaagagcgtc ttaaaaatga agcgaacact aaagcagcac acgaagaaaa ccgtcgtgta      1020
     gaagcgcata tcaaaacgat taaaaacgtt aaagttttac gttaa                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page