(data stored in ACNUC7421 zone)

EMBL: CR954246.PE174

CR954246.PE174       Location/Qualifiers
FT   CDS_pept        196306..196938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0185"
FT                   /product="putative biofilm formation, controlled by quorum
FT                   sensing, formation of cell aggregates"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /function="1.9.1 : Biofim formation"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 14729694"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85288"
FT                   /db_xref="InterPro:IPR018724"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IK57"
FT                   /protein_id="CAI85288.1"
FT                   /translation="MTALNPQNLLQLRFINQTNIDLVKPSFDNLPTNPYADGAFRKRRY
FT                   SVVKLQNGELKLQATKAFVQDDAINTFQGNVERSYENLEQSLLESAGMKSIVNEFRQIT
FT                   GIDEERDIEIHQFRMLAIDSDTPAAPEGVHQDGFDHVCVCGVSHENLEGGELLVYENKQ
FT                   ADPCFKMAIKDGMFAVINDRQVWHNATPMNKLDASKPGYLDCFVLTS"
     atgaccgctt taaaccccca gaatttactg cagctgcgtt ttattaacca aacaaatatt        60
     gatttggtta agccttcttt tgataacctg ccgactaatc cttatgcaga tggtgccttt       120
     cgtaaacgcc gttactctgt agttaaacta caaaatggtg agctaaagct acaagcaaca       180
     aaagcatttg tacaagatga tgcaattaat acctttcagg gtaatgttga gcgtagttac       240
     gaaaatttag agcaaagcct acttgagtca gcgggcatga aaagtattgt gaatgagttt       300
     cgtcaaatta ccgggattga tgaagaacgt gatatcgaaa ttcaccaatt tcgtatgtta       360
     gccattgata gtgatacgcc tgcagcgcca gaaggcgtgc accaagatgg ttttgatcat       420
     gtgtgtgtat gtggtgtatc gcatgaaaac ttagagggcg gtgaattgct tgtatacgaa       480
     aacaagcaag ccgatccctg ttttaaaatg gccataaaag acggtatgtt tgcagtaatt       540
     aacgaccgtc aagtgtggca taacgctact ccaatgaata aacttgatgc cagtaagcca       600
     ggttacctgg attgctttgt attaacgtct taa                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page