(data stored in ACNUC7421 zone)

EMBL: CR954246.PE176

CR954246.PE176       Location/Qualifiers
FT   CDS_pept        complement(198203..198907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0187"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85290"
FT                   /db_xref="GOA:Q3IK62"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IK62"
FT                   /protein_id="CAI85290.1"
FT                   /translation="MTDFIRVYDNALSNDFCDNFITTFSQSPHIKQGMTSGGIDLNKKD
FT                   SHDLHLNNHPEYVEQLKHIQQTTAQYVFKYIEEHIFIMIGAFGLKVYHPKSGEPVDLTH
FT                   ANFDEVGKPQLPLLVQQIFRLGNIQAQKYQVNKGGYPYWHSEVYPQLNHNEALHRVLLF
FT                   MFYLNDVEQGGETEFYYQKRKIAPKKGTMVIAPGYFTHTHRGNKPVSNDKYILTSWVLF
FT                   NRAEQIYGAPKS"
     atgacggact ttattcgcgt atacgataac gcgctcagca atgacttttg tgataacttt        60
     atcactacct tttctcaaag cccgcatata aaacaaggga tgacatctgg cggtatcgat       120
     ttaaataaaa aagatagcca cgacttgcac ttaaacaatc atccggaata cgttgagcaa       180
     ttaaaacaca ttcaacaaac cactgcacag tatgttttta aatacattga agaacatatt       240
     tttattatga ttggtgcctt tggcctaaaa gtgtatcacc ctaaaagtgg cgaacctgtt       300
     gacttaacac acgcaaactt tgatgaagtg ggtaaaccac aactgccctt attagtgcag       360
     caaattttta ggctaggaaa tattcaggcg caaaaatacc aagttaataa aggcggttac       420
     ccgtattggc acagcgaagt ttatccgcag ttaaatcata acgaggcgct acatagagta       480
     ttgctgttta tgttttattt gaacgatgtt gaacaaggtg gggaaacgga gttttattat       540
     caaaagcgta aaattgcgcc taaaaaaggc actatggtaa tagcgcccgg ctactttact       600
     cacactcacc gtggcaataa gccagtatct aacgataagt atattttaac ctcgtgggta       660
     ctgtttaacc gcgcagagca aatatacggt gcgccaaaga gctag                       705
//

If you have problems or comments...

PBIL Back to PBIL home page