(data stored in ACNUC7421 zone)

EMBL: CR954246.PE177

CR954246.PE177       Location/Qualifiers
FT   CDS_pept        198941..199339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0188"
FT                   /product="conserved protein of unknown function (could be a
FT                   thioesterase)"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85291"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IK61"
FT                   /protein_id="CAI85291.1"
FT                   /translation="MFIEKVMPRFSETDALGHINNTVLPVWFEASRAPIFRFFTPDLNP
FT                   HDWKLIIAKVEVSFVGELFYGHEVTIKTSVEHVGTSSFVLRQEAHQQGNCCAVGKTVLV
FT                   RYDFAAKAKQSLSVSEKSSLNEHLAPAS"
     atgtttattg aaaaagtgat gccgcgcttt agtgaaacag atgcgctagg acatattaac        60
     aataccgtac tccctgtatg gtttgaagct tcgcgtgcgc ctatttttag gttttttacc       120
     ccagatttaa acccacatga ctggaagcta attattgcca aagtcgaagt gtcgtttgtt       180
     ggtgagttat tttatggcca tgaagtaacc attaaaacct cagtagagca tgtaggtacc       240
     agctcatttg tattacgcca agaagctcac cagcaaggta actgctgtgc agttggtaaa       300
     acggtattgg tacgttacga ttttgcagca aaagcaaagc aatcgctttc agtatctgaa       360
     aaatcgtcac ttaatgagca tttagccccg gctagctag                              399
//

If you have problems or comments...

PBIL Back to PBIL home page