(data stored in ACNUC7421 zone)

EMBL: CR954246.PE180

CR954246.PE180       Location/Qualifiers
FT   CDS_pept        complement(202624..202866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0191"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85294"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IK58"
FT                   /protein_id="CAI85294.1"
FT                   /translation="MLGEDHSLTQDFPEHLNTIKKLNSNDPEFADKAKKYNALDKEIRT
FT                   LELQDAPIDDEEMLQLKHDRVVLKDWLHQQLLKAS"
     atgttaggcg aagatcattc attaactcaa gactttcctg agcacctaaa taccattaaa        60
     aaactcaata gcaatgatcc agagtttgca gataaagcca aaaaatacaa cgcgcttgat       120
     aaagaaattc gtaccttaga gctgcaagac gcgcctatcg atgacgagga aatgctgcaa       180
     ttaaaacatg accgtgtggt gttaaaagat tggctacatc aacaactgtt aaaagccagc       240
     taa                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page