(data stored in ACNUC7421 zone)

EMBL: CR954246.PE182

CR954246.PE182       Location/Qualifiers
FT   CDS_pept        203765..204925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0193"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85296"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFU0"
FT                   /protein_id="CAI85296.1"
FT                   /translation="MTEIVQQPRIVKMLNQRAHDLLLGHNFAHQQIGFIHTLEMDYGEP
FT                   LKQRTLLEVEVAAQQKRKLKSTAHHKYRAAASEQLHKAIEKMMSEQLSDIDSVIQNTIG
FT                   VEDSVCAMLDILATKSASVGRLEPLVNDLSWLGRELVTLVNLPYYRNQRSKNTAVKVDS
FT                   PALALRYIGLDNLQLVVPTFAVRHWMPYSTEPFSLLKRRLKESAMANAIAAQKIAEVNE
FT                   VNPSHAFTLGMLLNVGQIALVRLYLKVFEQIWQRKVQFARTTANKGLHTALLELKPDPL
FT                   FLTTLLSEQSLAISAKIIEKMAFKYLPFNSVMQQLVNGVEKGDTALPLTQVMLKARCYS
FT                   QYLTLKQHQLVEPDETLSWFSYFKFTKKELKALQASNFNNLAIQID"
     atgaccgaaa tagtgcagca accgcgtatt gttaaaatgc ttaatcaacg agcacatgat        60
     ttgctgcttg gtcataactt tgctcatcaa caaattggct ttattcatac gctagaaatg       120
     gactatggcg aaccactaaa gcaacgcaca ttacttgaag tagaggttgc cgctcagcaa       180
     aagcgcaagc taaaaagcac cgcgcatcat aaatatcgtg cagcagcgag cgagcaactg       240
     cataaagcaa tagaaaaaat gatgtctgag cagcttagcg atatagacag tgttattcaa       300
     aacaccatag gtgtagagga cagcgtatgt gccatgttag atattttagc cacaaaaagc       360
     gcatcggttg ggcgcttaga gcccttagtt aacgacctaa gctggcttgg cagagagtta       420
     gttactttag ttaacttgcc ttattatcgt aatcagcgca gcaaaaatac cgcagtgaaa       480
     gtagatagcc ccgctttagc gctgcgttat attggcctag ataacttaca gctagtagta       540
     ccaacttttg cagtgcgcca ttggatgcct tatagcacag agcctttttc gttactaaaa       600
     aggcgcttaa aagaaagcgc catggcgaat gctattgcgg cacaaaaaat tgctgaagtt       660
     aacgaggtta acccaagcca tgcttttact ttagggatgt tattaaacgt ggggcaaata       720
     gccttagtgc gtttatattt aaaagtgttt gagcaaattt ggcagcgaaa agtacaattt       780
     gctcgcacta cagcgaataa aggcttgcat actgcattgc tagagctaaa accagaccct       840
     ttatttttaa ccaccttact gagcgaacag tcgttggcta ttagcgctaa aataattgaa       900
     aaaatggcct ttaagtattt gccgtttaat agcgtaatgc agcaactcgt taatggggta       960
     gaaaaaggtg atacagcgct gcctttaacg caggtaatgc taaaagcacg atgttactct      1020
     cagtacttaa cgctaaagca gcatcagcta gttgaaccgg atgaaacgct tagttggttt      1080
     tcgtacttta agttcaccaa aaaagagcta aaagcactcc aagcaagcaa ttttaataat      1140
     cttgctattc aaattgatta a                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page