(data stored in ACNUC7421 zone)

EMBL: CR954246.PE186

CR954246.PE186       Location/Qualifiers
FT   CDS_pept        209218..209556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0197"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85300"
FT                   /db_xref="InterPro:IPR020979"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFT6"
FT                   /protein_id="CAI85300.1"
FT                   /translation="MVLNRQGYDDLIMYLTQNLALFEKPGEIKPGAPTVMELIEDVIAQ
FT                   NVMLICQQHTELTTEQRSQIVREVDGIVYDLQEVLSSITSRPVTVEQHMFIDEFGGLVK
FT                   NLFDNAVS"
     atggttttaa ataggcaagg gtacgacgac ttaattatgt acctaactca aaacttagct        60
     ttatttgaaa agccgggtga aataaaacca ggtgcaccta cggttatgga attaatcgaa       120
     gacgtgattg cacaaaacgt aatgctcata tgtcagcagc acacagagct cactacagag       180
     cagcgtagcc aaattgtgcg tgaagttgat ggcatagttt acgatttaca agaagtcctc       240
     agtagcatca cctcgcggcc tgttacggta gagcaacaca tgtttattga tgagtttggt       300
     ggtttggtta aaaacctatt tgataacgcc gtttcttag                              339
//

If you have problems or comments...

PBIL Back to PBIL home page