(data stored in ACNUC7421 zone)

EMBL: CR954246.PE187

CR954246.PE187       Location/Qualifiers
FT   CDS_pept        209726..210139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0198"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85301"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFT5"
FT                   /protein_id="CAI85301.1"
FT                   /translation="MQANVKWVEGNTFIGRSNSNHNVVFDGGSDSAAPSPMEMVLMSIG
FT                   CCSSVDVVSILKKAKQDFSNVEVQLTAERAETAPRVFTKVNLHFVATGNNVSEKHLARA
FT                   VSLSAEKYCSVALMLDKTVKITHSHEVVQDQVK"
     atgcaagcaa atgtaaaatg ggttgaaggt aataccttta ttggtcgctc taattcaaat        60
     cataatgttg tatttgacgg cggtagcgac agtgctgcac cgagccctat ggaaatggta       120
     ttaatgtcaa tcggttgttg ttcatcggtt gatgtagtga gcattttaaa aaaagccaaa       180
     caagatttta gcaacgtaga agtacagtta acggcagagc gcgccgaaac tgccccacga       240
     gtatttacca aagttaattt acactttgta gcaacgggca ataatgtgtc tgaaaagcac       300
     cttgcacgcg ctgtttcact ctctgctgaa aagtattgct cggtcgcatt aatgcttgat       360
     aaaacagtaa aaattacgca tagccacgaa gttgtgcaag atcaagtaaa ataa             414
//

If you have problems or comments...

PBIL Back to PBIL home page