(data stored in ACNUC7421 zone)

EMBL: CR954246.PE190

CR954246.PE190       Location/Qualifiers
FT   CDS_pept        complement(212505..212645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0201"
FT                   /product="putative membrane protein"
FT                   /function="1 : Cell envelope and membrane-associated
FT                   cellular processes"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0201"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85304"
FT                   /db_xref="GOA:Q3IFT2"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFT2"
FT                   /protein_id="CAI85304.1"
FT                   /translation="MQCVNFKLYGEKLLTPFLSAPFLLIIFNVELKPLPFSAHFYNAVA
FT                   N"
     ttgcagtgtg taaactttaa actttatggg gaaaagctat taaccccctt tttaagtgca        60
     cctttcctgc ttattatttt taacgttgag ctaaagccac tgccattctc tgctcacttt       120
     tataacgctg ttgcaaatta a                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page