(data stored in ACNUC7421 zone)

EMBL: CR954246.PE191

CR954246.PE191       Location/Qualifiers
FT   CDS_pept        212751..213221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0202"
FT                   /product="putative ribosome protein acetyltransferase"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85305"
FT                   /db_xref="GOA:Q3IFT1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFT1"
FT                   /protein_id="CAI85305.1"
FT                   /translation="MLLQFESENKAWFESMLPPREDYFYRDLGIKMHIYDAIINMQLGT
FT                   HYSGVLIVNEQIVARANLKDITGQTNTAAVGYRVAKNSIGKGYASFCLNELISIAAQHY
FT                   AVNKLEALVLDNNPASKAVLLKCGFKAQSHKDNYMTINGHTLGVTHFLRAPI"
     atgttattgc aatttgaatc agaaaataaa gcttggtttg aatcaatgct gccgccgaga        60
     gaggattact tttatcgcga tttaggcatt aaaatgcata tttatgatgc cattataaac       120
     atgcaattag gtacgcatta ttcgggtgtg cttattgtta atgagcaaat tgttgcgcgc       180
     gcaaatttaa aagatataac agggcaaaca aacactgccg cagtgggtta tcgagttgct       240
     aaaaatagca taggtaaagg ctacgccagt ttttgcctta acgaattaat tagcatagcc       300
     gctcagcatt atgcagttaa caagttagaa gccttagttc tagataataa ccccgcctca       360
     aaagccgtac tattaaagtg tggttttaaa gcccaatcac ataaagacaa ctacatgaca       420
     ataaacggac acacattagg cgttacacac tttttacgtg cgccgattta a                471
//

If you have problems or comments...

PBIL Back to PBIL home page