(data stored in ACNUC7421 zone)

EMBL: CR954246.PE193

CR954246.PE193       Location/Qualifiers
FT   CDS_pept        complement(213709..213837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0204"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85307"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILR5"
FT                   /protein_id="CAI85307.1"
FT                   /translation="MSIVPYINVLDTLSIVDDLSKVALDYELGRKLQDIELLNKKR"
     atgtctattg tgccttacat aaatgtgctt gacactctaa gtattgtgga tgacttaagt        60
     aaagtcgcac ttgattatga gttaggtaga aagctgcaag acattgagct tttaaataaa       120
     aaacgatag                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page