(data stored in ACNUC7421 zone)

EMBL: CR954246.PE194

CR954246.PE194       Location/Qualifiers
FT   CDS_pept        complement(213924..214076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0205"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85308"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILR3"
FT                   /protein_id="CAI85308.1"
FT                   /translation="MHFITLSTTMNPTQNKHLIFGSLLHSDFVFMTLLHQYDLTKLHFN
FT                   IKVKL"
     atgcatttta ttaccctctc tactactatg aaccccacac agaataagca tcttattttt        60
     ggctcacttt tacatagcga tttcgtattc atgacacttt tgcatcaata cgacctaacc       120
     aagctacact ttaatataaa agtgaaacta taa                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page