(data stored in ACNUC7421 zone)

EMBL: CR954246.PE195

CR954246.PE195       Location/Qualifiers
FT   CDS_pept        complement(214046..214192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0206"
FT                   /product="putative orphan protein"
FT                   /function="6.2 : Hypothetical"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85309"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILR7"
FT                   /protein_id="CAI85309.1"
FT                   /translation="MYSSPIPILKGQLYKTNLIFASESSNVNIASQLGCVGKLCILLPS
FT                   LLL"
     atgtattctt ctccgattcc aatattaaaa ggccaactct acaaaactaa tcttatattt        60
     gcatcagaaa gctctaatgt aaacattgct tctcaattgg gatgtgtagg aaagctatgc       120
     attttattac cctctctact actatga                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page