(data stored in ACNUC7421 zone)

EMBL: CR954246.PE196

CR954246.PE196       Location/Qualifiers
FT   CDS_pept        214195..215598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0207"
FT                   /product="conserved protein of unknown function"
FT                   /function="5 : Similar to unknown proteins"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85310"
FT                   /db_xref="InterPro:IPR011646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILR6"
FT                   /protein_id="CAI85310.1"
FT                   /translation="MEFKSNKIIIDPNDPFKNDKLGRKPHVENFTTLLKNISSPIVLSV
FT                   NAPWGQGKTTFLEMLEGNLQINNCSAIYFSAWETDFVNDPLQAFLGEVNKKIESLVEGD
FT                   KEKSKAWVKAKSAGAQILKKGLPVLVKLATAGIIDAGKITEAEAAKFTEGLSKDFLDDY
FT                   TKSKEAITSFKENVSKALKNEDGGASQLFIIIDELDRCRPTYAIELLERIKHLLDIEGL
FT                   VFVIAMDKLQLSHSVKGVYGAGFEAMGYLRRFIDIEYILPESDLDAFIEQLYKVFEFDI
FT                   FFQKRTQYQAFRYEKDYLKNTFKLLAKAKKLSLREVEQLFAKVNLVVKSTAENVYLYPD
FT                   LLAFLIVAKEYYYESYSGYINGGDTPEKLIQVLHSITPSLKSIDSRACAVIESSLIGAK
FT                   NDEYQGNIGGALKYHEDMSSDESASTDEQNYSHDVVQITKSFDGFRNSIDLESLKQRIE
FT                   MLESFKFNS"
     atggaattta aatcaaataa aataattatt gatccaaacg acccttttaa aaatgataag        60
     cttggacgaa aacctcatgt cgaaaacttt actacactcc tcaaaaacat tagctcaccg       120
     atagttttat ccgtgaatgc tccttgggga caaggtaaaa ctacattttt ggagatgtta       180
     gaaggtaacc tacaaataaa taattgttcg gcaatttatt ttagtgcgtg ggaaactgat       240
     ttcgtcaatg atccattaca agcatttctg ggtgaggtta ataaaaaaat agagtccctt       300
     gttgaaggag ataaagagaa aagtaaagca tgggttaaag ccaaaagtgc tggtgcacaa       360
     attttaaaaa aaggtttacc cgtgttagta aagcttgcta ctgctggaat aattgacgct       420
     ggaaaaataa ctgaagctga agcagccaaa tttacggaag gattatctaa agattttttg       480
     gatgattata caaagagtaa agaggctatt acttctttta aagagaatgt atcaaaagcc       540
     ttaaaaaatg aagatggagg tgcaagccaa ttatttatta ttattgatga attggatcgg       600
     tgcagaccta cttacgcaat tgagttacta gagagaataa aacatctttt agatattgaa       660
     ggtcttgtat tcgtaattgc aatggacaaa cttcaactgt ctcatagcgt taaaggggtc       720
     tatggtgcag ggtttgaagc aatgggttat cttaggcggt ttattgatat tgagtatatt       780
     ttacctgaga gtgatttaga cgcatttatt gaacagcttt ataaagtatt tgagtttgat       840
     attttctttc agaaaagaac tcaataccaa gcattcagat acgaaaaaga ttacttaaag       900
     aataccttta aactattggc aaaagctaaa aaactgtctt taagggaagt tgaacagtta       960
     tttgcgaaag taaacttagt agttaaatct acagcggaga atgtgtattt ataccctgat      1020
     ttattagcat tcttgattgt tgctaaagag tactattacg aaagttatag tgggtatatt      1080
     aatggaggag atacacctga aaagctgatt caagttcttc attcaataac ccccagtttg      1140
     aaatcaatag attctagagc gtgcgcagta attgaaagct ctttaattgg agcaaaaaat      1200
     gatgaatacc aaggtaatat tggaggcgcg ctaaagtatc atgaagatat gagttctgat      1260
     gaaagtgcta gtacagatga acaaaactat tcacatgatg tagtacaaat tacaaaaagt      1320
     tttgacgggt ttcgaaattc gattgattta gagagtttaa agcagaggat agaaatgcta      1380
     gaaagcttca aattcaatag ttaa                                             1404
//

If you have problems or comments...

PBIL Back to PBIL home page