(data stored in ACNUC7421 zone)

EMBL: CR954246.PE203

CR954246.PE203       Location/Qualifiers
FT   CDS_pept        222904..223650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0214"
FT                   /product="putative sugar-phosphate aldolase"
FT                   /function="2.1.3.1 : Carbohydrates (other than glucose)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 8939754; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85317"
FT                   /db_xref="GOA:Q3ILQ8"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILQ8"
FT                   /protein_id="CAI85317.1"
FT                   /translation="MIKQQKEAALAVALMDLTSLNSNDDSAAINTLVNSINPKLGTPAA
FT                   VCVYSDFVAEAKIALATRELSHIKVATVTNFPTGDAPLNTVINETLIAIERGADEIDLV
FT                   IPYKALIAGDKSRVLEYVTESKKVCGSRALLKVIIESGELQTPDLIASATLLAIKGGAD
FT                   FVKTSTGKVAVNATLDATKTILNTIKESGKLVGFKAAGGVKTVADASDYLTLASTIMGN
FT                   DYLQANTFRFGASSLLTNVYAVLNEA"
     atgattaaac aacaaaaaga ggctgctttg gctgtcgcct taatggattt aaccagctta        60
     aatagcaacg atgatagtgc cgctattaat acgttagtga acagcattaa ccctaaatta       120
     ggcacgcccg ctgcagtatg tgtttacagt gattttgtag cagaagcaaa aatagcctta       180
     gctaccagag agctaagcca tataaaagta gccacagtaa ctaactttcc aacgggtgac       240
     gcacctttaa ataccgtaat aaacgaaaca ctaattgcca tagagcgcgg tgcagatgaa       300
     attgatttag ttattccata taaagcgcta atagcgggtg ataaaagccg tgtgcttgag       360
     tatgttaccg agagcaaaaa agtctgtggg tcgcgcgctc tacttaaagt gattatagaa       420
     agcggcgagt tacaaacacc cgatttaatc gcatcagcca cattattagc tattaaaggc       480
     ggtgccgact ttgtaaaaac cagtaccggt aaggtcgccg ttaatgccac gcttgatgcg       540
     acaaaaacta tactcaatac cattaaagaa tcgggcaagc tagttggctt taaagcggcg       600
     ggaggagtta aaacagttgc agatgcgagc gattacttaa cccttgcaag cactattatg       660
     ggtaatgact acttacaagc aaataccttt agatttggcg catcaagttt attaactaat       720
     gtgtacgcgg tattaaatga agcgtga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page