(data stored in ACNUC7421 zone)

EMBL: CR954246.PE204

CR954246.PE204       Location/Qualifiers
FT   CDS_pept        223694..224140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0215"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85318"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILQ7"
FT                   /protein_id="CAI85318.1"
FT                   /translation="MFLRCYEQQYGIHMRHIWHNEPNKPDVSCYKGDQQLDIEVAHLYA
FT                   SETEAMAVLGRPLSIPMQRALADMAQAPSEQRLRLALERLLEQKATKSYHSARTWLLIR
FT                   NASTIWHKADFDAQLKMISVPQTHAFEQIWLLRDFYRGELVRLF"
     ttgtttttac gttgttatga gcagcaatat ggcattcata tgcgccatat ttggcataat        60
     gagcccaata agcccgacgt tagctgctac aaaggcgatc agcaacttga tattgaagtt       120
     gcgcatttat atgccagtga aaccgaagca atggcagtgc ttggccggcc actgtcaatt       180
     ccaatgcaac gggcattggc cgatatggcg caagccccaa gtgagcaaag gttacgccta       240
     gcgttagaga gattactgga gcaaaaagcc actaaatctt atcattcagc gcgaacttgg       300
     ttattaattc gcaatgccag cactatttgg cataaagccg actttgatgc tcagcttaaa       360
     atgattagtg tgccgcaaac gcatgcattt gagcaaattt ggttgctacg cgatttctat       420
     cgtggcgagt tggtacgttt attttga                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page