(data stored in ACNUC7421 zone)

EMBL: CR954246.PE229

CR954246.PE229       Location/Qualifiers
FT   CDS_pept        253820..255028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0240"
FT                   /product="putative general secretion pathway protein L"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0240"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85343"
FT                   /db_xref="GOA:Q3ILN2"
FT                   /db_xref="InterPro:IPR007812"
FT                   /db_xref="InterPro:IPR024230"
FT                   /db_xref="InterPro:IPR025691"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILN2"
FT                   /protein_id="CAI85343.1"
FT                   /translation="MTEILLIRTGQTEQELLNWLIYSPQEQQIIASGELVNASYLNELS
FT                   EKSLGREVVVLLPCDQVQLKTVMLPTKWNRKLEQALPYMLEEDIACDIDELFIAVGEPV
FT                   MIGEQHAVRVAMTDREWFEAWLALFAEHNLSVYKILPDALLLPPADEDTVTAIALNNQW
FT                   LFKQGPWRISAVETSWLNGYLTAMGNPDVKHFSPATQFPETVNLQAQTSDYDLPLALFA
FT                   KQLEHTKFNLRQGMYQLKKKSTLWWGYWKSAAIITSVALVASITIKAIELHQLNTQLEL
FT                   AKAQVIERYQKAFPGTKVRPHLIKNQIKGALAKIQDTSDAGFLELTTELVGVFSQVSNF
FT                   TPETLRYDKKRNELRMRARAKDFQTFGKVKAILEQQGLTVDQGSLSNDGDFVVGEIKLR
FT                   GAV"
     gtgacagaaa tactgttgat ccgcacgggt caaaccgaac aagagttact taattggtta        60
     atatactcac cacaagaaca acaaataata gccagtggtg agctagttaa tgccagttat       120
     ttaaacgaac tgagcgaaaa atcgctaggg cgcgaagtcg ttgtattatt gccttgtgac       180
     caagtgcaat taaaaacggt aatgctaccg actaaatgga atcgtaagtt agagcaagct       240
     ttgccttata tgctcgaaga agatatagcg tgcgatatag atgagctatt tattgctgta       300
     ggtgagccag tgatgattgg cgagcagcat gctgttcgtg ttgctatgac cgaccgcgaa       360
     tggtttgagg cgtggctagc gctatttgca gagcataatt tatcggtata taaaatatta       420
     cccgatgctt tgttattacc cccagcagat gaggacacag taacggcaat agcacttaat       480
     aatcagtggt tatttaaaca aggcccatgg cgtataagtg cagtagagac gagctggtta       540
     aatggttact taacagcaat gggtaatcca gatgtaaagc attttagtcc ggcgactcag       600
     tttcctgaaa cggtaaactt acaggctcaa accagtgatt acgacctacc gctggcctta       660
     tttgctaagc aactagagca tactaagttt aatcttcgcc aaggtatgta tcagcttaaa       720
     aagaaaagca ccttatggtg ggggtactgg aaaagtgctg ccattattac cagcgttgcc       780
     ttagtagcga gtattacgat taaagctata gagttgcatc agctaaatac ccagttagaa       840
     cttgctaaag cacaggtaat tgagcgctac caaaaggcat ttccgggaac taaggttcgc       900
     ccacacctta ttaaaaacca aattaaaggt gcactggcaa aaatacaaga taccagcgac       960
     gctggatttt tagagttaac cacagaatta gtgggggtgt tttcacaggt aagtaatttt      1020
     acccctgaaa cactgcgtta tgacaaaaaa cgtaatgaat tacgtatgag agcacgcgca      1080
     aaagactttc aaacctttgg taaagttaaa gccatacttg aacagcaagg gttaacggtt      1140
     gatcaaggtt cgttaagtaa cgatggtgac tttgtggttg gcgaaattaa actgcgaggt      1200
     gcagtatga                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page