(data stored in ACNUC7421 zone)

EMBL: CR954246.PE230

CR954246.PE230       Location/Qualifiers
FT   CDS_pept        255025..255498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0241"
FT                   /product="putative general secretion pathway protein M"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85344"
FT                   /db_xref="GOA:Q3ILM0"
FT                   /db_xref="InterPro:IPR007690"
FT                   /db_xref="InterPro:IPR023229"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILM0"
FT                   /protein_id="CAI85344.1"
FT                   /translation="MKQQLIKHWRSLKEQEQQLIIVASGIFIVFILVMGIFRPLNNAIA
FT                   SAEQSQLKQQELLVWVDESIVKLKAAGNTQVVNSQNISQIVNATRGRYKINISKMQPSN
FT                   NSLRLTLDSVEFNQLILWLDELVNQHGLRVENLDLSRDDKSGYVRVSRLLLEK"
     atgaagcagc agttaattaa acattggcgc tcactaaaag agcaagagca gcagttaata        60
     atcgttgcga gtggtatttt tattgtgttt attttagtga tgggcatttt tagaccctta       120
     aataatgcaa tagcaagtgc tgagcaatcg caattaaaac agcaagagct actagtgtgg       180
     gttgacgaaa gtattgtaaa gctcaaggcc gctggtaata cacaagtggt taatagtcaa       240
     aacattagcc aaatagttaa cgccacccgc ggacgctata aaataaatat tagtaaaatg       300
     cagccaagta ataactcgct acgtttaacg ctcgactcag tagagtttaa tcaattaata       360
     ctgtggcttg atgaactggt caatcaacat ggtttacggg tcgaaaattt agatttgagc       420
     cgtgacgata agtcgggcta tgtacgtgtt agccgtttgc tattagagaa gtaa             474
//

If you have problems or comments...

PBIL Back to PBIL home page