(data stored in ACNUC7421 zone)

EMBL: CR954246.PE231

CR954246.PE231       Location/Qualifiers
FT   CDS_pept        255502..256260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0242"
FT                   /product="putative general secretion pathway protein N"
FT                   /function="4.2 : Detoxification"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85345"
FT                   /db_xref="InterPro:IPR022792"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILN0"
FT                   /protein_id="CAI85345.1"
FT                   /translation="MKKIITLSIVFLLSFIVFCIIKLPVAVAIDLAKPYFPKQLEVGQS
FT                   VGTIWQGQMMQVRYQGEQLNNVRWDVAGWALFTGKLNANVKFGDPRERSDISGYADVSF
FT                   GLFNKQVKVTNGLVRSTVERAMQRIQLPLPVTAKGRVILELAEYTSGAPYCESLQGEIA
FT                   SPNIDVQGLNGWFNIGPLGGNLSCKSGDIAILIDPDNTLGLEADATLKANFDFKVSGYV
FT                   KPDATLPKDVHDAVKFLGRPDNQGRYPLNF"
     atgaaaaaaa taataacctt atccattgta tttttactta gttttattgt gttttgtatt        60
     attaagttac ctgtagcggt ggccattgac ctagcaaaac cttattttcc taagcaactt       120
     gaagtagggc aaagtgttgg cactatttgg caaggacaaa tgatgcaagt gcgctaccaa       180
     ggtgagcaat taaataatgt gcgttgggat gttgccgggt gggcattatt taccggtaag       240
     ttaaatgcca atgtaaaatt tggtgaccca cgtgagcgca gtgatatatc gggttatgca       300
     gatgtgagct ttggtttatt taataagcaa gtgaaagtaa ccaatggatt agtgcgctca       360
     acagttgaaa gagcgatgca acgcatacaa cttccgttac ctgtaaccgc taaaggtcgt       420
     gtgatcttgg aattggcaga gtatacatcg ggtgcacctt attgtgagtc actgcaaggc       480
     gagatagcga gccctaatat tgacgtacaa ggtttgaacg gttggtttaa tataggcccg       540
     cttggtggta acctaagctg taaatcgggc gacatagcca tacttatcga cccagataac       600
     accttagggc ttgaagctga tgcaacccta aaagctaatt ttgactttaa agtatcaggc       660
     tatgtaaagc ccgatgccac gttgccaaaa gatgtacatg atgcggttaa gtttttaggt       720
     cgtccagata atcaaggccg ttacccgctc aacttttaa                              759
//

If you have problems or comments...

PBIL Back to PBIL home page