(data stored in ACNUC7421 zone)

EMBL: CR954246.PE232

CR954246.PE232       Location/Qualifiers
FT   CDS_pept        256282..256869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0243"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85346"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILM9"
FT                   /protein_id="CAI85346.1"
FT                   /translation="MQLPQFTEQHAKQLSTFLDTQSQAMTLTQSQGYLFGVICSPEPLD
FT                   VHEWMAAILPNTANNVDEEMLFLFMALYHQISEQVFEVGYKLPAQYNYEFCSNWSAGFV
FT                   TATTSYTQKLLSSTALEAEYKQALESAQATLSFFALDGQTISQIALQNSIDEQLLCQQQ
FT                   YELMGDFALGFAELVEIVALNSGLYTDEGWEE"
     atgcaattac cccaatttac tgagcagcac gctaagcagc tcagcacatt tttagacacc        60
     cagtctcaag cgatgacgct aacgcaaagc caaggttatt tatttggcgt aatttgctct       120
     cctgagcctc tagacgtaca tgagtggatg gcagcaattt tgcctaatac agctaataat       180
     gtagatgaag aaatgctatt tttatttatg gcgctatacc atcaaattag tgagcaagta       240
     tttgaagtag gctataaatt accagcacaa tataattacg aattttgcag taattggagc       300
     gcaggttttg taacggcaac aacgtcatat actcaaaagt tattaagttc aaccgcgtta       360
     gaggcagaat ataaacaagc cctcgaaagc gctcaagcca cattaagctt ttttgcactt       420
     gatgggcaaa ccattagcca aatagcgtta caaaacagta ttgatgagca gttactttgc       480
     cagcagcaat atgagctaat gggcgacttt gcgcttggct ttgcagagct agtggaaata       540
     gtcgcgctta atagtggctt gtacacagat gaaggctggg aagagtag                    588
//

If you have problems or comments...

PBIL Back to PBIL home page