(data stored in ACNUC7421 zone)

EMBL: CR954246.PE234

CR954246.PE234       Location/Qualifiers
FT   CDS_pept        complement(257124..257483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0245"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0245"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85348"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILM7"
FT                   /protein_id="CAI85348.1"
FT                   /translation="MKKFIILVIVVLAFFTVDHPLVKEPRERLFNDGIDFLSDASKVNR
FT                   SPTASMTKNKISAQLTLSESEREYTEKTFTTDDSIRLFHLRYCRERDLNLYFYDERLNT
FT                   VCKIVSGSLEHMRGK"
     atgaaaaaat ttattatttt ggtaatagta gtcctcgcct ttttcacagt cgatcaccct        60
     ttggtgaaag agcctcgtga gcggttattt aacgatggta ttgacttttt aagtgatgca       120
     agcaaagtga atcgcagccc tactgccagt atgactaaaa acaaaattag tgcgcagtta       180
     acgctttctg aatctgagcg tgagtacacc gaaaaaacat ttactaccga tgactcaata       240
     agattatttc acttacgcta ctgccgtgag cgcgacttaa acctatattt ttatgatgag       300
     cgcttaaaca ctgtatgtaa aatagtatcc ggctcactag aacacatgcg aggtaaataa       360
//

If you have problems or comments...

PBIL Back to PBIL home page