(data stored in ACNUC7421 zone)

EMBL: CR954246.PE235

CR954246.PE235       Location/Qualifiers
FT   CDS_pept        257764..259194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0246"
FT                   /product="conserved protein of unknown function ; putative
FT                   4Fe-4S ferredoxin, iron-sulfur binding domain"
FT                   /function="1.4.2 : Electron transport"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85349"
FT                   /db_xref="GOA:Q3ILM6"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014116"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR032879"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILM6"
FT                   /protein_id="CAI85349.1"
FT                   /translation="MDKQIKVKNIPVEVKIQKPDLSGQQDRFNPRNRIYVRAVNGLHQL
FT                   LRQRIGFLGLLAFMLLPWINFNGEQAVLFDLIGQKYNIFGLTLWPQDFTILAFIFMLAA
FT                   FALFLVTTFYGRVWCGYTCPQTVWTFTFIWFEEKFEGTANQRKKLDQRAMDFDKFWRKT
FT                   AKHTSWILFSLYTAITFVGYFTPIRELLPDFVTFNAGSYALMSIIFFAACTYGNAGWMR
FT                   EIMCLHICPYSRFQSAMFDKDTYTVSYDEKRGESRGPRSRKVAHQDLEIGDCIDCNLCV
FT                   QVCPTGIDIRNGLQAECINCGACIDACDGVMDKMNYPRGLISYTTERNLETPENKTNPL
FT                   RAKIIGYIVILVILTSALVANIALRKTMEFDIIRDRNQLYRVDFEGLVENTYTLKVINK
FT                   AQYEQTFTIKVQGLDNFKYIGKQTFRVNAGQSHNVPLSLVMDPYDLKAPMTEFNFVLSP
FT                   VGEPDNQISQSSNFFKAR"
     atggacaaac aaattaaagt aaaaaatata ccagttgaag taaagattca aaagccggat        60
     cttagcgggc aacaggatcg gtttaatcca cgtaatcgta tttacgtgcg tgctgttaat       120
     ggcttgcacc aacttcttag gcagcgaatt ggctttttag gtctgttggc atttatgttg       180
     ctaccttgga taaattttaa tggtgaacag gccgttttat ttgatttaat aggtcaaaaa       240
     tacaatatat ttggtttaac cctgtggccg caagacttta ccatactcgc ctttattttt       300
     atgttggccg cgtttgcttt gtttttggtt actacttttt atggacgagt gtggtgtggt       360
     tatacctgcc cacaaacagt gtggaccttt acctttattt ggtttgaaga aaagtttgaa       420
     ggtacggcaa atcaacgtaa aaagctcgac caacgagcaa tggactttga taagttttgg       480
     cgcaaaaccg ctaagcacac cagttggatt ttgttttctt tatatacagc aattacattt       540
     gttggttact ttacccctat tcgtgagcta ctccctgact ttgttacctt taatgccggt       600
     agctatgcct taatgagtat tatctttttt gctgcttgta catacggtaa tgctgggtgg       660
     atgcgcgaaa ttatgtgttt acatatttgc ccatactcac gttttcagtc agccatgttt       720
     gataaagata cctatacagt atcgtatgat gaaaaacgcg gtgaaagccg tggcccacgc       780
     tcgcgcaaag tggcacacca agatttagaa ataggcgact gtattgactg taatttatgc       840
     gtgcaagtat gcccaaccgg catagatatt cgtaatggct tacaagcaga gtgtattaac       900
     tgtggcgctt gtattgatgc atgtgatggg gtgatggata aaatgaatta tccacgcgga       960
     cttatttctt ataccactga gcgaaactta gaaacgccag agaataaaac caacccactg      1020
     cgggcaaaaa ttattggcta tatagtgatc ctggttattt taaccagtgc cttggttgcc      1080
     aatattgcgc tgcgtaaaac gatggaattt gatattattc gcgatcgtaa tcagttatat      1140
     agggttgatt ttgaagggtt ggtagaaaac acctacacct taaaagtgat caacaaagcg      1200
     cagtatgagc aaacctttac aattaaagtg caagggctcg ataactttaa gtacataggt      1260
     aaacaaacgt ttagggttaa cgcagggcaa tcgcacaacg tgcctttatc actggttatg      1320
     gatccgtatg acttaaaagc gccaatgaca gaatttaact ttgtgctatc gccggtaggc      1380
     gagcccgaca atcaaatatc acagtcgagt aactttttta aagcgcggta a               1431
//

If you have problems or comments...

PBIL Back to PBIL home page