(data stored in ACNUC7421 zone)

EMBL: CR954246.PE24

CR954246.PE24        Location/Qualifiers
FT   CDS_pept        27007..28128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0024"
FT                   /product="conserved protein of unknown function ; putative
FT                   LysM domain protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85138"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDI1"
FT                   /protein_id="CAI85138.1"
FT                   /translation="MKSPLIAIIVALGAAFSTYADVLKIKKDAPKQYVVKKGDTLWDIS
FT                   GVYLNEPWLWPELWQLNPQINNPHLIYPGDALALIYDAQGNPRLVINKAYRKLSPQGRI
FT                   TPKGKNAITTLPLEMIRPYITYEQAINSDDIKAKPYILGANENTKTQTLGHILYVKGDL
FT                   KLHQAYAIYHKGKPYLDPETGRVLANRAAYVGMARAFRKGDAANGEPASVRVESVKREI
FT                   KQGDFLLPAMEGQMLPAYFNMHRPTQAVLGYVIASPSDSREFSTMDVVVLNLGSEQQVE
FT                   VGHVLDIERQSPSVIDGPRGPRYTEDSSRFEKLISNANEFFGAEPDDGSTVWKMPKEKV
FT                   GELIVFKVYDNVSYALITKNQHPIRVGDIAVIH"
     atgaaatctc cattaattgc aattatcgtt gcattaggtg ctgcattttc tacttatgct        60
     gatgtgctaa aaataaaaaa agatgcacct aaacagtatg ttgtgaaaaa aggcgataca       120
     ctttgggata tttctggggt ttatttaaac gaaccttggc tatggcctga gttgtggcaa       180
     ttgaacccgc aaattaataa ccctcacctt atttatcccg gcgatgcctt agcattaatc       240
     tacgatgcgc agggaaatcc acgtttagtg ataaataaag cgtaccgaaa gctgtctcct       300
     caggggcgaa ttacccctaa aggcaaaaat gcaattacca ccttgccact agaaatgatc       360
     agaccttata taacttatga gcaagctata aatagcgacg atataaaagc taaaccttat       420
     attttagggg caaacgagaa cacgaaaaca caaacgttag ggcatatttt atacgttaaa       480
     ggcgatttaa agttacacca agcttatgca atttatcata aaggtaagcc atatttagac       540
     ccagaaactg gaagggtact tgctaatcgt gctgcttatg ttggtatggc tcgcgccttt       600
     agaaaaggtg atgccgctaa tggtgagcct gcatcggtca gagttgagtc ggtgaagcgc       660
     gaaataaaac aaggcgactt tttacttcca gcaatggaag ggcaaatgct accagcgtat       720
     tttaatatgc atcgtcctac ccaggctgta ttgggttatg ttattgcttc gccaagcgat       780
     tctagagaat ttagcactat ggatgtagtg gtgctaaact taggatcaga gcagcaagta       840
     gaagtgggtc atgtacttga tattgaacgc caatcaccaa gcgttataga tggtcctcgt       900
     ggtcctcgct acaccgagga ctcaagtcgc tttgagaagt taatttcaaa tgctaacgag       960
     ttttttggtg ctgaacccga tgatggaagt acggtttgga aaatgccgaa agaaaaagta      1020
     ggtgagttaa ttgtatttaa ggtgtatgac aacgtaagtt atgcgctaat aactaaaaat      1080
     cagcacccaa ttcgcgttgg agatattgca gttattcatt aa                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page