(data stored in ACNUC7421 zone)

EMBL: CR954246.PE240

CR954246.PE240       Location/Qualifiers
FT   CDS_pept        262872..263999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0251"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85354"
FT                   /db_xref="InterPro:IPR041651"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILM1"
FT                   /protein_id="CAI85354.1"
FT                   /translation="MKIGNFGFVPNHNINKYGNKGALQQPTIQSPQDNYQQRGKELAAK
FT                   VLGDKMAQALGLPISEPKKDKPLFDFDEIVKNVLDFVTSAVRKAKANGADDEKLKGMLG
FT                   DARKGVQIGIDDAVDELKGNGVFNDDIAQGINKSKEGIFNGLDKFEDDLFNPKPASVSV
FT                   SQAQYASLSNKAEYKFTTAEGDEVSISFADAYESQSASRYQQNGNSESFVSESSQSREL
FT                   SFSMSVNGDLNENEQKAINELMADLQSVSSTFFSGDLDKAFEEAQALSLGNEQLVAFSM
FT                   DLRQTKTVATVKGYEEYKPVPEKAVADKLAPFNDDLKAVFNKATELGIQNQLSGIVQWL
FT                   NQDQAEIDKLVDYTKAMFENLNQLNAATDELANQQ"
     atgaaaatcg gtaactttgg ctttgttcca aaccacaata ttaataaata cggtaataaa        60
     ggggctttac agcaacctac aatccagtcg cctcaagata actatcagca gcgcggtaaa       120
     gaacttgctg ccaaagtgct cggtgacaaa atggctcaag ctcttggctt accgataagc       180
     gagccgaaaa aagataaacc gctttttgat tttgatgaaa tcgttaaaaa cgttttagac       240
     ttcgttacca gtgcagtacg taaagcaaaa gccaatggtg ccgacgatga aaaactcaaa       300
     ggtatgttag gtgatgctcg aaaaggtgtg caaataggga ttgatgacgc ggttgatgaa       360
     ttaaaaggca atggcgtgtt taacgacgat atcgcacagg gtattaataa atctaaagaa       420
     ggcatattta atggcctgga caaatttgaa gacgatttat ttaatcctaa acccgccagt       480
     gtctctgtta gccaagctca gtatgcaagt ttaagtaaca aagcagaata taaatttact       540
     accgccgaag gagacgaagt gagtattagt tttgctgatg cctatgagtc acaatcagcc       600
     agtcgttatc agcaaaatgg gaatagtgaa tcttttgtaa gtgagtcgtc gcagtctcgt       660
     gagttgtcat tttctatgtc ggttaatggc gatttaaatg agaatgaaca aaaggcgatt       720
     aatgagctaa tggctgactt acaaagtgta agtagcacct ttttcagtgg agacttagat       780
     aaagcatttg aagaggcgca agcactaagc ttaggcaacg aacagctggt ggctttttca       840
     atggatttac gacaaaccaa aacagtcgct acagttaaag gttacgaaga gtacaagcca       900
     gttcctgaaa aagcagtagc tgataaatta gcgccgttta acgacgactt aaaagctgtg       960
     tttaataaag ccacagagct gggcatacaa aaccagttat cgggtattgt gcagtggtta      1020
     aatcaagatc aagcagaaat agataaattg gtagattaca ccaaagctat gttcgaaaac      1080
     cttaatcaat taaatgcagc aacggacgag ctagccaatc aacaatag                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page