(data stored in ACNUC7421 zone)

EMBL: CR954246.PE242

CR954246.PE242       Location/Qualifiers
FT   CDS_pept        complement(264837..265316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0253"
FT                   /product="conserved protein of unknown function ; putative
FT                   RNA-binding domain"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0253"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85356"
FT                   /db_xref="GOA:Q3IDS6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDS6"
FT                   /protein_id="CAI85356.1"
FT                   /translation="MKLPDQKSFILSVILAVVGFVIVKFALESLELDPALLFAVGLLIG
FT                   GIVIAAMSSDGVVEAEVKTKTLYVGNLPYRANEGVVRALFEEQGKVFNVRLLKDKNTGK
FT                   RRGFGFVEMAQADADNAIAQLNDSEFQQRTLKVREAKQKQEDDSNALRSEPDQSV"
     atgaaattac ccgatcaaaa atcttttatc ctctcagtta ttcttgctgt tgttggtttt        60
     gttatagtta agttcgcact tgaaagccta gagttagacc ctgcactact atttgctgtt       120
     ggtttgctca ttggtggtat tgttattgct gcgatgtcgt ctgacggtgt agtagaagcc       180
     gaagtaaaaa ccaaaacgct ttatgttggt aaccttcctt atcgtgcaaa cgaaggtgtg       240
     gtgcgtgctt tatttgaaga gcaaggcaaa gtgttcaacg ttcgcttatt aaaggacaaa       300
     aatacaggta agcgtcgtgg ctttggtttt gttgaaatgg cgcaagctga tgccgacaat       360
     gcaatagcgc agttaaacga tagcgagttc caacaacgta ccttaaaggt acgtgaagca       420
     aaacaaaaac aagaagatga ttctaacgct cttcgttctg agccggatca atcagtgtaa       480
//

If you have problems or comments...

PBIL Back to PBIL home page