(data stored in ACNUC7421 zone)

EMBL: CR954246.PE246

CR954246.PE246       Location/Qualifiers
FT   CDS_pept        complement(274850..275326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0261"
FT                   /product="putative FxsA protein (Suppressor of F exclusion
FT                   of phage T7)"
FT                   /function="1 : Cell envelope and membrane-associated
FT                   cellular processes"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10497016, 10497017; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0261"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85360"
FT                   /db_xref="GOA:Q3IDT5"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDT5"
FT                   /protein_id="CAI85360.1"
FT                   /translation="MFRFLFVLFIIIPIIEIALLIQVSEVIGGFSTIALVIITAILGAK
FT                   MVKQQGMSALQKAQTQMAEGQMPAKELFTGICVIIAGVLLLTPGIMTDVFGLLLLTPVI
FT                   RNKLAAGLASQATVRMSAGMQQGGSPFTQHSQTEADPHQVNKPTIIDGEFERKD"
     atgtttagat ttttatttgt gttgtttatc attattccta ttattgaaat cgccttactt        60
     atacaagtaa gcgaggtaat aggtggtttt tcgacaattg cgctagtaat tattaccgcg       120
     attttaggcg caaaaatggt aaaacaacaa ggtatgagcg cgctacaaaa agcacaaact       180
     caaatggccg aagggcaaat gcctgcgaaa gaattattta ctggtatatg cgttattata       240
     gctggcgtat tattgttaac gcctggcatt atgaccgacg tttttgggct actattatta       300
     acgccagtaa ttcgcaacaa actggcagcc ggccttgcta gccaagctac tgtacgtatg       360
     agtgcaggta tgcaacaagg tggttcacca tttacccagc acagtcaaac tgaggcagat       420
     cctcatcaag tgaacaaacc gaccatcata gatggtgagt ttgaacgaaa agattaa          477
//

If you have problems or comments...

PBIL Back to PBIL home page